KEGG   Sphingobium sp. SYK-6: SLG_05620Help
Entry
SLG_05620         CDS       T01622                                 

Definition
(GenBank) quinohemoprotein alcohol dehydrogenase
  KO
K17760  quinohemoprotein ethanol dehydrogenase [EC:1.1.9.1]
Organism
ssy  Sphingobium sp. SYK-6
Brite
KEGG Orthology (KO) [BR:ssy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SLG_05620
Enzymes [BR:ssy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.9  With a copper protein as acceptor
    1.1.9.1  alcohol dehydrogenase (azurin)
     SLG_05620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PQQ PQQ_2 PQQ_3 Cytochrome_CBB3 Cytochrom_C550 LPAM_1
Motif
Other DBs
NCBI-ProteinID: BAK65237
NITE: SLG_05620
UniProt: G2ILH4
Position
583527..585674
Genome map
AA seq 715 aa AA seqDB search
MARQAKRFLSTALLALALAGCGGGREEADKGPGAIDQARLEAAASDDDNWLTYGRTYAEQ
RFSNLTQINDGNVGELSPAWVVELDTTRGQEGTPIVVDGILYTSTAWSKVVAVNAATGQK
LWQFDPENEGSKAAHACCDVVNRGIAVWKGRVYVGTIDGRLIAIDAKTGQKVWETITVDQ
KKPYTITMAPRVVRDKVIIGNSGAELGVRGYVSAYDTATGKLVWRFYTVPGNPADGPDGA
ASDEAIEKLARPTWSGDNYWKLGGGGTVWDSVVYDQELNQLLVGVGNGSPWNHKWRSEGK
GDNLFLSSIVALDPDTGKYKWHYQVNPGETWDYTATQGIMLADLKIDGKDRKVFMQAPKN
AFFYVVDRTNGKLISAKPYAYQNWAEGIDLKTGRPIEKPNVRYEDGPQLIIPSGIGAHAW
MPMSYSPKTGLVYIPAMEHPLVYGDAKPFEIHEGRWNTAVSFLDPPPLPGLPDTVEGRRK
ALEGMVKGKLVAYDPIAQKPVWEVQRDWPWNGGTLATAGNLVFQGTAKGDFEAYRADNGQ
KLWAFQTHRGVLAGPITYRVNGEQYVAVMAGYGGSMGMASGTPFMKNKMPNGLIIAFKLK
GKATLPPYTPIPLDKPTPSDERFTAAQIATGQKYFFTFCQICHGGPVNPDLRRSTLLREK
DVWQQVVIDGALSQNGMASFRDYLTPAQAEGIRAYLNQRAKELLKEEEAKDAKAD
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggcaggcaaagcggtttctgagcaccgcgctgctggcactggccctcgccggc
tgcggcggcggcagggaggaagcggacaagggccccggcgcgatcgaccaggcccggctc
gaagcggccgcaagcgatgacgacaactggctgacctatggccgcacttatgccgagcag
cgcttctccaacctcacgcagatcaatgacggcaatgtcggcgaattgtcgccggcatgg
gtcgtcgagctggacaccacgcgcgggcaggaaggcacgccgatcgtggtggacggcatc
ctctacacctccaccgcatggtccaaggtggtcgccgtcaacgccgcgaccggacagaag
ctctggcagttcgatccggagaatgagggctccaaggcggcccatgcctgctgcgacgtc
gtcaatcgcggcatcgcggtgtggaagggccgggtctatgtcggcaccatcgacggccgg
ctcatcgccatcgacgcgaagacgggccagaaggtctgggaaacgatcaccgtcgaccag
aagaagccctataccatcaccatggcgccgcgcgtggtgcgcgacaaggtcatcatcggc
aacagcggcgcggaactgggcgtgcgcggctatgtctcggcctatgacaccgcgacgggc
aagctggtctggcgcttctacaccgtgccgggcaatccggcggacgggccggacggcgcc
gcctcggacgaagccatcgagaagcttgcccggccgacatggtccggcgacaattactgg
aagctgggcggcggcggaacggtgtgggattccgtcgtctacgaccaggagctgaaccag
ctcctcgtcggcgtcggcaacggctcgccctggaaccacaaatggcgcagcgagggcaag
ggcgacaatctgttcctttcctccatcgtcgcgctcgatccggataccggcaagtacaag
tggcactatcaggtcaatcccggcgagacatgggactataccgccacgcagggcatcatg
ctcgccgacctcaagatcgacggcaaggaccgcaaggtcttcatgcaggcgccgaagaac
gcgttcttctatgtggtcgatcgcaccaacggcaagctgatctcggccaagccctatgcc
tatcagaactgggccgagggcatcgatctcaagaccggccgcccgatcgagaagcccaat
gtgcgctatgaggacgggccgcagctcatcatcccgtcgggcatcggcgcccatgcctgg
atgccgatgagctattcgcccaagaccggcctcgtttacatccccgcgatggagcatccg
ctggtctatggcgacgccaagccgttcgagatccatgagggccggtggaacacggccgtc
tccttcctcgatccgccgccgctccccggcctgccggacacggtggaaggccgccgcaag
gcgctcgagggcatggtgaagggcaagctggtcgcttatgatccgatcgcgcagaagccg
gtctgggaagtgcagcgcgactggccgtggaacggcggcacgctggccaccgccggcaat
ctcgttttccagggcaccgcgaaaggcgatttcgaggcttatcgggccgacaacgggcag
aagctctgggccttccagacgcatcgcggcgtgcttgccgggccgatcacctatcgcgtc
aatggcgagcaatatgtcgcggtgatggcgggctatggcggatcgatgggcatggcctcg
ggcacgccgttcatgaagaacaagatgcccaatggcctcatcatcgccttcaagctgaag
ggcaaggccacgctgccgccctatacgccgatcccgctcgacaagccgacgccgagcgac
gagcggttcacggcggcgcagatcgccaccgggcagaaatatttcttcaccttctgccag
atctgccatggcggcccggtcaacccggatctgcggcgctcgacgctgctgcgggagaag
gacgtgtggcagcaggtggtcatcgatggcgccttgtcgcagaacggcatggcgagcttc
cgcgactatctcactcccgcgcaggcggaaggcattcgcgcctatctgaaccagcgcgcg
aaggaattgctgaaggaagaggaagccaaggacgccaaggcggactga

DBGET integrated database retrieval system