KEGG   Sphingobium sp. SYK-6: SLG_05740Help
Entry
SLG_05740         CDS       T01622                                 

Gene name
nagZ
Definition
(GenBank) beta-N-acetylhexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
ssy00520  Amino sugar and nucleotide sugar metabolism
ssy01100  Metabolic pathways
ssy01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ssy00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SLG_05740 (nagZ)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    SLG_05740 (nagZ)
Enzymes [BR:ssy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SLG_05740 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: BAK65249
NITE: SLG_05740
UniProt: G2ILI6
Position
597493..598506
Genome map
AA seq 337 aa AA seqDB search
MKPVIFGLAGARVSEAERALFRACDPAGYILFGRNIRDRAQVRALTGELREIAGRDDLFI
MVDQEGGRVARMRAPEWPDYPPAAAFDALYELAPSSAIEAARCNARALGAMLAEVGITAD
AAPVLDVRQEGASDIVGDRSFGSEPMRVAALGRATLDGLRAGGAVGIVKHMPGHGRALVD
SHHALPTVTASSWDLESDMAPFRALNGAPAGMTAHIVYTAWDAERPASLSPRVIGEIIRG
AIGFDGLLMSDDLDMKALSGAADELAAGVIAAGCDLALNCWGRMAEMTAIAARLPDMSDR
GRERLARAMETIADGPDADWPIELSLATRDALLAQRA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaagccagtgatcttcggccttgcgggcgcgcgagtgagcgaggcggagcgcgcgctg
ttccgcgcctgcgatccggcgggctacatcctcttcggccgcaacatccgcgaccgcgcg
caggtccgcgcgctgaccggcgagctgcgcgagatcgccgggcgcgacgatctgttcata
atggtcgatcaggaaggcggccgggtcgcgcggatgcgcgcgccggaatggccggattat
ccacccgccgccgcgttcgacgcactttacgagctggccccatcgagcgcgatcgaggcg
gcgcgctgcaacgcgcgcgcgctcggcgcgatgctggccgaggtcggcatcacggcggac
gcggcgccggtgctggacgtgcggcaggaaggcgccagcgatatcgtgggcgatcggtcg
ttcggcagcgagccgatgcgcgtcgcggcgctcggccgcgcgacgctggacggcctgcgg
gccggcggcgcggtgggcatcgtcaagcatatgccgggtcatggccgggcgctggtggac
agccatcatgcgctgcccaccgtcaccgcgagcagctgggacctggaaagcgacatggcg
ccgttccgcgcgctcaacggcgcgccggcgggcatgacggcccatatcgtctacactgcc
tgggacgcggagcgccccgccagcctttcgccgcgcgtgatcggcgagatcattcgcggc
gccatcggctttgacgggctgctgatgtccgacgatctcgacatgaaggccctgagcggt
gcggcggacgaactggcggccggcgtcatcgcggcgggctgcgatctcgcgctcaattgc
tggggccggatggcggaaatgaccgccatcgccgcccggctgcccgacatgagcgatcgc
ggacgcgagcgactggcgcgggcgatggagacgatcgccgacgggccggacgcggactgg
ccgatcgaactgtcgctcgccacgcgcgatgccctgctggcgcaacgggcatga

DBGET integrated database retrieval system