KEGG   Sphingobium sp. SYK-6: SLG_05880Help
Entry
SLG_05880         CDS       T01622                                 

Gene name
murE
Definition
(GenBank) UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
  KO
K01928  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
ssy00300  Lysine biosynthesis
ssy00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ssy00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SLG_05880 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SLG_05880 (murE)
Enzymes [BR:ssy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     SLG_05880 (murE)
Peptidoglycan biosynthesis and degradation proteins [BR:ssy01011]
 Precursor biosynthesis
  Amino acid ligase
   SLG_05880 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase
Motif
Other DBs
NCBI-ProteinID: BAK65263
NITE: SLG_05880
UniProt: G2IM08
Position
609743..611173
Genome map
AA seq 476 aa AA seqDB search
MMRLSTFLPDLESAAGDAAVSGFAIDHRKVAPGTIFGAFRGARLNGEDFIPAAVAAGAIA
VVARPEAKVEGAVHIADEDPRRLFAALAARYYAPYPETVVGVTGTNGKTSTVELTRQLWR
MLGHKSASIGTLGVTTSVDQVSTGLTTPDIVTFLSNMAGLAREGISHVAYEASSHGLAQF
RSEGLRVAAGAFTNLSRDHLDYHGTMEHYFAAKMRLFDEVVAPDGTAVVWADDERSGAVI
EHARARGLRVVTVGTKGETLRLAGRTPTQLGQTLLIEAEGATHKVELPLIGAYQAANALT
ATGLVLATGGALKEVLGLLARVQPVRGRLERAVITRVGAPVYVDYAHTPDGLRAAIEALR
PHTRGRLITLFGAGGDRDAGKRPLMGRVASELSDMVIVTDDNPRSEEPQVIRAAIMAGAP
DAREIGGRRAAIAAAIAEAGPDDIVLLAGKGHEQGQIIGDRVLPFDDVTVARECAA
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgtctctcgacctttcttcccgacctcgagtccgctgcgggcgacgcggcggtg
agcggcttcgccatcgatcatcgcaaggtggcgcccggcaccattttcggcgcgttccgg
ggcgcgcggctgaacggcgaggacttcatccccgcggccgtcgcggccggggcgatcgcg
gtcgtcgcgcggcccgaagcgaaggtcgagggtgccgtccacatcgccgacgaggatccg
cgccgcctgttcgccgcgctcgccgcgcgttattatgcgccttatcccgagacggtggtg
ggggtgaccggcaccaacggcaagacatcgacggtggaactcacgcgccagctctggcgg
atgctcgggcacaagtccgcgtccatcggcacgctgggcgtcaccacctcggtcgatcag
gtgtcgaccggcctcaccacgccggacatcgtgacatttctttccaacatggctggcctc
gccagggaaggcatcagccatgttgcttatgaggcgtcgagccacggtctggcgcagttc
cgcagcgagggcttgcgcgtcgccgccggcgccttcaccaatctgagccgcgatcatctc
gattatcacggcaccatggagcattatttcgccgcgaagatgcgcctgttcgacgaggtc
gtggcgcccgacgggacggcagtggtctgggcggacgacgagcgctcgggcgcggtgatc
gagcatgcgcgcgcgcgcggcctgcgggtcgtcacggtcggcacgaagggcgagacgctg
cgcctcgccggccgcacgccgacccagctcggccagacgctgctgatcgaggcggaaggc
gcgacgcacaaggtggagctgccgctgatcggcgcctatcaggccgccaacgcgctgacc
gccacggggctggtgctggcgacgggcggcgcgctcaaggaggtgctgggcctgctcgcg
cgggtgcagccggtgcggggacggctggaacgcgcggtcatcacgcgcgtcggcgcgccg
gtctatgtcgattatgcccacacgcccgatggcctgcgcgccgcgatcgaggcgctgcgg
ccgcacacacgggggcggctcatcacgctgttcggggccggcggcgaccgggacgcgggc
aagcggccgctgatggggcgcgtggccagcgaactcagcgacatggtgatcgtgaccgac
gacaatccgcgcagcgaggaaccgcaggtcattcgcgccgcgatcatggccggtgcgccg
gacgcgcgcgagatcggcgggcgccgtgccgccattgccgccgccatcgcggaagcgggg
ccggacgacatcgtcctgctcgccggcaagggccatgaacaggggcagatcatcggcgac
agggtgctgccattcgacgacgtcacggtcgcacgggaatgcgccgcatga

DBGET integrated database retrieval system