KEGG   Sphingobium sp. SYK-6: SLG_06500Help
Entry
SLG_06500         CDS       T01622                                 

Definition
(GenBank) putative carboxyltransferase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
ssy00620  Pyruvate metabolism
ssy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SLG_06500
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ssy02000]
    SLG_06500
Enzymes [BR:ssy01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     SLG_06500
Transporters [BR:ssy02000]
 Other transporters
  Primary active transporters [TC:3]
   SLG_06500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA
Motif
Other DBs
NCBI-ProteinID: BAK65325
NITE: SLG_06500
UniProt: G2IM70
Position
complement(674338..675804)
Genome map
AA seq 488 aa AA seqDB search
MADIKLVETSLRDGNQCLWGALGVDTARTLSIAPVLERVGFKAIDFTTSTHMGVAVRYKQ
EDPWERIRLMKQACPTTPLQFLSTGFRFIAWETASPDFMALAFATLMKNGIGRFALADPM
NDAEANVQVARMIKRDGDAYVVGALVFTLSPIHDDAHYAQAAATMAASPDIDALYIKDPG
GLLSPQRARTLIPAILAVIGDKPLELHAHCTIGLGEQSYYEAAGLGVEALQGASGGLGDG
TSNPPLERVVANLRALGHSVDIDDAALAEAGRYFTDLAQAEGLPTGAPMPFDAAYLQHQL
PGGMVGTMRRHLADHRVPHLEGAVVEELGRVREELGWPIVMTPFAQMVMTQAVMNVTGTE
RYSVIPDEVIRYAIGRFGRPNQPIAPNVLDRIMALPRTKELAAEPGMADLPDLRKRIGTH
LPDEEFLLRATMPAGQVDAMQAAGPAPRHYDPTLRPAMALIRKLLARTDIDRVSVEKAGF
RLELESHG
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggcagacatcaagctcgtcgaaacgtcgctgcgcgacggcaaccagtgtctgtggggg
gcgctcggcgtggacaccgcccgcactctctccatcgcgccggtgctggaacgcgtcggc
ttcaaagcgatcgacttcaccacgtcgacgcatatgggcgtggcggtgcgctacaagcag
gaggacccgtgggagcgcatccggctgatgaagcaggcctgccccaccacgccgctgcag
ttcctctccaccggcttccgcttcattgcctgggagacggcgagcccggacttcatggcg
ctggccttcgccacgctcatgaagaacggcatcggccgcttcgccctcgccgatccgatg
aacgatgccgaggccaatgtgcaggtggcgcggatgatcaagcgcgacggcgatgcctat
gtggtcggcgcgctggtcttcacgctgagccccattcatgacgatgcccattatgcgcag
gccgccgcgacgatggcggccagcccggatatcgacgcgctctacatcaaggatccgggc
gggctgctctcgccccagcgcgcgcggacgctcatccccgcgatcctcgccgtgatcggc
gacaagccgctggaactccacgcccattgcaccatcggcctgggcgagcagagctattat
gaggccgccgggctcggcgtggaggcactgcagggcgcatccggcgggctgggcgacggc
acatccaatccgccgctcgagcgcgtggtcgccaatctgcgcgcgctcggccacagcgtc
gacatcgatgacgcggcgctggcggaggccgggcgctacttcaccgatctcgcgcaggcc
gagggactgccgaccggtgcgcccatgcccttcgatgcggcctatctccagcaccagttg
cccggcggcatggtcggcaccatgcggcggcatctggccgaccatcgcgtgccgcatctg
gaaggcgccgtggtggaggagctgggccgcgtgcgcgaggagctgggctggccgatcgtg
atgacgcccttcgcccagatggtgatgacgcaggcggtgatgaacgtgaccgggacagag
cgctacagcgtgatcccggacgaagtgatccgctatgcgatcggccggttcggccgcccc
aaccagcccatcgcccccaatgtgctcgaccggatcatggccctgccgcgcacgaaggaa
ctcgccgccgagcccggcatggccgacctgccggacctgcgcaagcgcatcggcacccat
ctgccggacgaggaattcctgctgcgcgcgaccatgcccgccgggcaggtggacgcgatg
caggccgccggtcccgcgccgcgccattacgacccgacactccgcccggccatggcgctg
atccgcaagctgctggcccggacggacatcgaccgggtgagcgtggagaaggccggcttc
cggctggaactggaaagccatggctga

DBGET integrated database retrieval system