KEGG   Sphingobium sp. SYK-6: SLG_07720
Entry
SLG_07720         CDS       T01622                                 

Gene name
ligZ
Definition
(GenBank) 2,2',3-trihydroxy-3'-methoxy-5, 5'-dicarboxybiphenyl dioxygenase
  KO
K15061  OH-DDVA oxygenase
Organism
ssy  Sphingobium sp. SYK-6
Pathway
ssy00627  Aminobenzoate degradation
ssy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ssy00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SLG_07720 (ligZ)
SSDB
Motif
Pfam: LigB
Other DBs
NCBI-ProteinID: BAK65447
NITE: SLG_07720
UniProt: G2IMZ9
Position
818825..819835
AA seq 336 aa
MAEIVLGMWTSHGPTLSTTPEQWTLRVSADLKRKHPFRGEEYSFEELVSLRSGEKLAEAC
SLPERERRAAGCQSAIADMADRFAAAKIDVAVIMGNDQRELFLEDVTPAITVYLGETIWD
QPATPEQAARMPPGIHEAEWGHSPPERRDYPCQPELGMHVCKTLVPQGFDLAVSKTLPEP
AGHWSSGAPHSLGFIYRQIMRDQVVPNLPIIINTFFPPNQPTARRCFELGRAVGKAIRSW
KEDLRVAVFGSGGMSHFVIDEDFDRMFFEALRNRDAETLCAIEDKHLQSGTSELKTWIAA
AGALFDTDLKGDVVGYEPCYRSEAGTGTANGFVAWQ
NT seq 1011 nt   +upstreamnt  +downstreamnt
atggccgaaatcgtgctgggtatgtggacgtcgcacgggccgaccctgtccaccacgccg
gagcaatggacgctccgggtttccgcggatttgaagcggaagcaccccttccgtggcgag
gaatacagcttcgaggaactggtctcgctgcgcagcggcgagaagctggcggaggcctgt
tcccttcccgagcgcgagcgacgcgcggccgggtgccagagtgccatcgccgacatggcc
gaccgcttcgcggccgcgaagatcgacgtcgcggtcatcatgggcaatgaccagcgggag
ctgttcctggaggatgtcacgccggcgatcactgtctatctcggcgagacgatctgggac
cagccggccacgcccgagcaggccgcgcggatgccacccggcattcacgaggcggaatgg
gggcatagcccgcccgagcgccgggactatccctgccagcccgagctcggcatgcatgtg
tgcaaaacgctggtgccgcagggcttcgatctggcggtctccaagacactgcccgagccc
gccggccactggtcgagcggcgcgccgcattcgctcggcttcatctaccgccagatcatg
cgtgatcaggtggtgcccaacctgccgatcatcatcaacaccttcttcccgccgaaccag
ccgaccgcccggcgctgcttcgagctggggcgcgcggtcggcaaggcgatccgcagctgg
aaagaggacctgcgcgtggcggtgttcggctcgggcgggatgagccacttcgtcatcgac
gaggatttcgaccgcatgttcttcgaggcgctgcgcaatcgggacgcggagacgctgtgc
gccatcgaggacaagcatctccagtccggcacctccgagctcaagacctggattgcggcg
gccggcgcgctgttcgacacggacctgaagggcgacgtggtgggctatgagccctgctac
cgctccgaagccgggaccggcaccgccaacggcttcgtcgcctggcaataa

DBGET integrated database retrieval system