KEGG   Sphingobium sp. SYK-6: SLG_08440Help
Entry
SLG_08440         CDS       T01622                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
ssy00260  Glycine, serine and threonine metabolism
ssy00750  Vitamin B6 metabolism
ssy01100  Metabolic pathways
ssy01110  Biosynthesis of secondary metabolites
ssy01120  Microbial metabolism in diverse environments
ssy01230  Biosynthesis of amino acids
Module
ssy_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ssy00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SLG_08440 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SLG_08440 (thrC)
Enzymes [BR:ssy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SLG_08440 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: BAK65519
NITE: SLG_08440
UniProt: G2IN71
Position
897177..898580
Genome map
AA seq 467 aa AA seqDB search
MQYVSTRGRADALDFEGATLAGLASDGGLYLPERWPTFTAADLSAMRGLSYVETAVRVIL
PFVGDSLSEDELRDLCTQAYGRFAHAAVTPLVQLDHGHWLLELFHGPTLAFKDVALQLLG
LLFEKFLSRRETHLTIIGATSGDTGSAAIDAVAGRAGIDIFMLHPAGRVSDVQRRQMTTV
LAPNVHNIAIEGSFDDAQALVKRAFNDPDFSSRYDLSAVNSINWARLVAQVVYYIYAGVR
LGAPDRSVAFAVPTGNFGDVFAGYVASRMGLPIERLVVATNVNDILHRALSEGDYSQGTV
VPTATPSMDIQVSSNFERLLFDLNGRDGAALAEQMKGFEQTRAMRLTNAQRDGAAALFSS
ARIDADGMSRAMRWAYDAAGQIIDPHSAIGLAAARAAAVDPSVPMVTLATAHPAKFRDAV
ERATGVRPGLPSRTGDLFGREERYVTLPATFEAVTDYIAGHAVKRGS
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatgtgagcaccagggggcgcgcggacgcgctggatttcgaaggcgcgaccctg
gcggggctcgcgagcgacggcgggctctatctgcccgagcgctggccgaccttcacggcg
gcggacctctccgccatgcgcgggctctcctatgtggaaacggcggtgcgagtcatcctg
ccgttcgtgggggacagcctcagcgaagatgagctgcgcgatctatgcacgcaggcttat
ggccgcttcgcgcatgccgccgtcacgccgctcgtccagctcgaccatggtcactggctg
ctggagctgtttcacggcccgacgctggcattcaaggatgtcgcgcttcagctgctggga
ctgctgttcgagaaattcctcagccgacgcgagacacatctcacgatcatcggcgcgacc
tccggcgacaccggctctgcagcgatcgatgccgtcgcggggcgcgccgggatcgacatc
ttcatgctgcacccggccggccgtgtgtcggacgtgcagcggcggcagatgacgacggtg
ctggcgcccaatgtccacaacatcgcgatcgagggcagtttcgatgatgcgcaggcgctg
gtgaagcgcgcgttcaacgatcccgatttctcttcccgctacgatctgtcggcggtcaac
agcatcaactgggcgcggctggtcgcgcaggttgtttattatatctatgccggcgtccgc
ctcggcgcgccggatcgctcggtggccttcgccgtgccgaccggcaatttcggcgatgtg
ttcgcgggctatgtggcctcgcgcatgggccttccgatcgagcggctggtcgttgcgacc
aacgtcaacgacatccttcaccgcgcgctgtccgaaggcgattacagccagggcacggtc
gtccccaccgcgacgccgagcatggatatccaggtctcgtccaatttcgaacggctgctg
ttcgacctgaacggccgggatggcgcggcgctggccgagcagatgaagggcttcgagcag
acaagggccatgcgccttaccaatgcgcagcgtgatggcgcggctgccctgttctcctcc
gcgcggatcgatgcggacggcatgtcgcgcgccatgcgctgggcctatgacgcggccggg
cagatcatcgatccgcatagcgcgatcggtcttgccgccgcccgcgccgcggcggtggac
ccgtccgtgcccatggtgacgctggcaacggcgcatcccgccaagttccgcgatgccgtc
gagcgcgcgacaggtgtgcgcccgggcctgccgtcccgcacgggcgacctgttcgggcgc
gaggagcgctacgtgacgctcccggcgaccttcgaggccgtgaccgactatatcgccggg
cacgccgtgaagcggggcagctga

DBGET integrated database retrieval system