KEGG   Sphingobium sp. SYK-6: SLG_11940Help
Entry
SLG_11940         CDS       T01622                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ssy  Sphingobium sp. SYK-6
Pathway
ssy00020  Citrate cycle (TCA cycle)
ssy00190  Oxidative phosphorylation
ssy00650  Butanoate metabolism
ssy01100  Metabolic pathways
ssy01110  Biosynthesis of secondary metabolites
ssy01120  Microbial metabolism in diverse environments
ssy01130  Biosynthesis of antibiotics
ssy01200  Carbon metabolism
Module
ssy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ssy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ssy_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ssy00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SLG_11940 (sdhD)
   00650 Butanoate metabolism
    SLG_11940 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    SLG_11940 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: BAK65869
NITE: SLG_11940
UniProt: G2IQ41
Position
1291837..1292226
Genome map
AA seq 129 aa AA seqDB search
MGTGTGVGRVRGLGSARSGTHHWVAQRVTAVGNALLVTWFVVSLAMLPSYDHAAVTGWLA
QPIVALPMMLMIANLFYHIRLGLQVLIEDYVHDEGLKFATLILLHFFVIGCAAVGLFSVA
RIAFAGGAF
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgggcacgggaacgggagtaggccgcgtccgcggtctcggatcggcgcgcagcggcacg
catcattgggtcgcgcagcgcgtgacggcggtgggcaatgccctgctggtcacctggttc
gtcgtcagcctcgcgatgctgccatcctatgatcatgccgcggtcaccggctggctcgcc
cagcccatcgtcgcgctgccgatgatgctgatgatcgccaatctcttttaccatatccgg
ctggggctgcaggtgctgatcgaggactatgtccatgacgagggcctgaagttcgccacg
ctcatcctgctccatttcttcgtgatcggctgcgcggccgtcggtctcttctcggttgcc
cgaatcgcatttgccggaggcgcgttctga

DBGET integrated database retrieval system