KEGG   Sphingobium sp. SYK-6: SLG_24730Help
Entry
SLG_24730         CDS       T01622                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
ssy00071  Fatty acid degradation
ssy00072  Synthesis and degradation of ketone bodies
ssy00280  Valine, leucine and isoleucine degradation
ssy00310  Lysine degradation
ssy00362  Benzoate degradation
ssy00380  Tryptophan metabolism
ssy00620  Pyruvate metabolism
ssy00630  Glyoxylate and dicarboxylate metabolism
ssy00640  Propanoate metabolism
ssy00650  Butanoate metabolism
ssy00900  Terpenoid backbone biosynthesis
ssy01100  Metabolic pathways
ssy01110  Biosynthesis of secondary metabolites
ssy01120  Microbial metabolism in diverse environments
ssy01130  Biosynthesis of antibiotics
ssy01200  Carbon metabolism
ssy01212  Fatty acid metabolism
ssy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ssy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SLG_24730
   00630 Glyoxylate and dicarboxylate metabolism
    SLG_24730
   00640 Propanoate metabolism
    SLG_24730
   00650 Butanoate metabolism
    SLG_24730
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SLG_24730
   00072 Synthesis and degradation of ketone bodies
    SLG_24730
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SLG_24730
   00310 Lysine degradation
    SLG_24730
   00380 Tryptophan metabolism
    SLG_24730
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SLG_24730
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SLG_24730
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SLG_24730
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssy04147]
    SLG_24730
Enzymes [BR:ssy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SLG_24730
Exosome [BR:ssy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SLG_24730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAK67148
NITE: SLG_24730
UniProt: G2IIX8
Position
complement(2663362..2664567)
Genome map
AA seq 401 aa AA seqDB search
MNDGFPDMTTNATLILSYARTPMGGFQGNLSGASATELGTAAVRAAVERAGVDPAAVERC
YMGCVLPAGLGQAPARQAARGAGLPDHVEATTINKMCGSGMKAAMMAADAIAAGSAELIV
AGGMESMSNAPYLMKKHRAGARIGHDVIYDHMMLDGLEDAYEPGKAMGVFAEGTARDYQF
TREAQDAYAIESLTRAQKAQAGGWFEKEIVPVEVTSRKGSQTVAQDEQPLKGDPAKIPSL
RPAFAKDGTITAANASSISDGAAALVLAGEGWVAANGVRPVARIVAHTAHARLPAHFTTA
PVGAIEKLLAKTGWRVEDVDLFEINEAFAVVTMAAMHDLSIPHEKVNIHGGATALGHPVG
ASGARIVATLLSALERTGGRRGIASLCIGGGEATAMAVELL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
ttgaatgatggatttccggacatgacgacgaacgccacgctcattctctcttatgcccgc
acgccgatgggtggattccagggcaacctttccggcgccagcgcgacggagctcggcacc
gccgccgtcagggctgcggtcgagcgcgcgggcgtcgatccggcggcggtcgaacgctgc
tatatgggctgcgtgctgccggcggggctcgggcaggcgccggcgcgccaggccgcgcgc
ggggcagggctgcccgatcatgtcgaggcgaccaccatcaacaagatgtgcggcagcggc
atgaaggcagcgatgatggcggcggacgccatcgcggcggggtcggccgagctgatcgtc
gcgggtggcatggagagcatgtccaacgcgccctatctcatgaagaagcaccgggccggc
gcccgcattggccatgatgtcatttatgaccacatgatgctcgatgggctggaggatgcc
tatgagccgggcaaggcgatgggcgtcttcgccgagggcacggcgcgcgactatcagttc
acgcgcgaggcgcaggatgcctatgcgatcgaatccctgacccgggcgcagaaggcgcag
gcaggcggctggttcgaaaaggaaatcgtcccggtcgaagtgacaagccgcaagggctcg
caaaccgtcgcgcaggacgagcagccgctgaagggcgatcccgcgaagatcccgagcctg
cggccggcatttgcaaaggacggtacgatcactgccgccaatgccagctccatttcggac
ggcgcggccgcgctggtgctggcgggcgagggctgggtagcggccaacggcgtgcgcccg
gtcgcgcggattgtggcccatacagcgcatgcccggctgcccgcccatttcaccaccgcc
cctgtcggggcgatcgagaagctgctggcgaagaccggctggcgcgtcgaggatgtcgac
ctgttcgagatcaacgaggcattcgccgtcgtcaccatggcggcgatgcatgacctctcc
attccgcacgagaaggtgaacatccatggcggggcgacggcgctcggccatccggtcggc
gcgtccggcgcgcgcatcgtggcgaccctgctctccgcgctggagcgcaccggcggacga
cgcggcatcgcgtcgctgtgcattggcggcggcgaggcgacggcgatggcggtggaactg
ctctga

DBGET integrated database retrieval system