KEGG   Sphingobium sp. SYK-6: SLG_24940Help
Entry
SLG_24940         CDS       T01622                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
ssy00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ssy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SLG_24940
Enzymes [BR:ssy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     SLG_24940
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     SLG_24940
    1.1.1.-  
     SLG_24940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Pyr_redox_2 PALP Pyr_redox_3 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: BAK67169
NITE: SLG_24940
UniProt: G2IIZ9
Position
2687230..2688237
Genome map
AA seq 335 aa AA seqDB search
MRAAIMQGLNKPLRVDTLPDPVPGEGELVVKVGRCGICGSDLHMTEDPGYGKGAGDVLGH
EFAGEIVALGKGVTGFRTGELVSVSPLRSCGHCAACRAGDVAWCAQFGLQAGGYAEYALT
RPNQCVKLPDTLSLADGAIVEPLAVARHGIALSGIRAGDRVLVLGAGPIGLAVAFWARRA
GAAAVIVQDIADWQRERALIMGATGFIVDRDDPVGAATRALGGPADIVFECVGVPGLIAQ
AVQQVRPRGTILLLGLCNQPDTFNSFAMLSKEIRLVTSAFFTQGEYEAALDALDRGAAEP
RALVTETISLARTPEIFESLKRRTHQCKVMIAPGE
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccgccatcatgcagggcctgaacaagccccttcgcgtggatacgcttcccgat
cccgtgcccggcgaaggcgagctggtggtgaaggtcggccgctgcggcatctgcggctcc
gacctgcacatgacggaagaccctggctacgggaaaggcgcgggcgacgtgcttggccac
gagttcgccggcgagatcgtcgctctgggcaagggcgtcaccggttttcgcaccggcgag
cttgtctcggtcagtccgctcaggagctgcgggcactgcgcggcctgccgggcgggcgat
gtcgcctggtgcgcgcagttcggactgcaggcgggcggctatgcggaatatgcgctcacc
cgccccaatcagtgcgtgaagctccccgatacgctcagccttgcggacggcgccatcgtc
gaaccgctggccgtggcacggcacggcattgccttgtccggcatccgcgcgggcgaccgg
gtgctggtgctgggcgccgggccgatcggcctcgccgtggccttctgggcccgccgggcc
ggcgcggcggccgtgatcgtgcaggacatcgccgactggcagcgcgagcgcgcgctcatc
atgggcgcgaccggtttcatcgtcgaccgggacgatccggtgggtgccgcgacccgcgcg
ctcggcggcccggcggacatcgtgttcgagtgcgtcggcgtgcccggcctcatcgcgcag
gccgtgcagcaggtgcgcccgcgcggcaccatcctgctgcttggcctgtgcaaccagccc
gacacgttcaacagcttcgccatgctttccaaggagatccggctggtcacctcggccttc
ttcacgcagggcgaatatgaggcggcgcttgacgcgctggaccggggcgccgccgaaccg
cgcgcgctcgtgaccgaaacgatcagcctcgcccggacgccggagatcttcgaaagcctc
aagcgccgcacgcatcagtgcaaggtgatgatcgcaccgggcgaatag

DBGET integrated database retrieval system