KEGG   Sphingobium sp. SYK-6: SLG_26140
Entry
SLG_26140         CDS       T01622                                 
Name
(GenBank) putative lytic transglycosylase
Organism
ssy  Sphingobium sp. SYK-6
SSDB
Motif
Pfam: SLT SLT_2 SLT_4
Other DBs
NCBI-ProteinID: BAK67289
NITE: SLG_26140
UniProt: G2IJT1
Position
complement(2825464..2826090)
AA seq 208 aa
MAALKTIAVALALLVAAPASARVAEDPVSRWQPIIAEASQRFGLPEAWIIAVMRAESRGR
TTLDGQPITSRAGAMGLMQLMPGTYAEMRGRLGLGPDPHDPRDNILAGAAYLRLMHDRFG
YPGLFGAYNAGPTRYAEHLRTGRPLPGETRAYLAVLARMPFSPAMPPGILSGDRLFFSAG
RATGQPPRQPNGNGIFVDLNTASDRARP
NT seq 627 nt   +upstreamnt  +downstreamnt
gtggcggcgctgaagacgatcgcggtcgcgctggcactgctggtcgcggccccggcaagc
gctcgtgtcgctgaagatccggtctcgagatggcagccgatcatcgccgaagcctcacag
cgcttcggcctaccggaagcctggatcattgccgtcatgcgcgccgaaagccgcggaagg
acgaccctcgatggccaaccgatcaccagccgtgccggagcgatgggcctgatgcagctc
atgccgggcacctatgcggaaatgcgcggccggctcgggcttgggcccgatcctcatgat
ccgcgcgacaacatcctggcgggcgcggcctatctgcggctgatgcatgatcggttcggc
tacccggggctgtttggggcctacaatgccggcccaacacgctatgcggagcaccttcgg
acgggccgtccgcttccgggcgagacccgggcctatctcgcggtgcttgcccggatgcca
ttttcgcctgccatgccgcctggcattctttccggcgacaggctgtttttctctgcgggc
agggctactggacagcccccccgacagccgaatggcaatggcatttttgtcgatctaaac
acggcttccgaccgcgcgcgaccatag

DBGET integrated database retrieval system