KEGG   Sphingobium sp. SYK-6: SLG_28030Help
Entry
SLG_28030         CDS       T01622                                 

Definition
(GenBank) 3-oxoadipate CoA-transferase alpha subunit
  KO
K01028  3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
ssy00072  Synthesis and degradation of ketone bodies
ssy00280  Valine, leucine and isoleucine degradation
ssy00650  Butanoate metabolism
ssy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SLG_28030
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    SLG_28030
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SLG_28030
Enzymes [BR:ssy01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     SLG_28030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-ProteinID: BAK67478
NITE: SLG_28030
UniProt: G2IKS6
Position
3027507..3028217
Genome map
AA seq 236 aa AA seqDB search
MANKIHPDPASALSGLLFDGMTIMSGGFGLSGNPESLIPEIRRAGVKDLTVISNNAGADG
FGLWMLLESRQIRKMISSYVGENKLFEAQYLAGELELELTPQGTLAERIRAGGAGIPAFY
TKTGVGTLVAQGKPTEFFDGEEYVRETWLRADLSIVKAWRADTAGNLMFRKTARNFNPNM
ATAGRVTVAEVEEIVPAGTFDPDCIHTPGIYVDRIVLNTINEKRIEKRTTRPREVA
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacaagatccatccagatccggcgtccgcgctgagtggcctcctcttcgacggc
atgaccatcatgtccggcgggttcggcctctccggcaacccggaaagcctgatccccgaa
atccgccgggccggcgtcaaggacctcaccgtcatttcgaacaatgccggcgcggacggc
ttcggcctctggatgctgctggagagccgccagatcaggaagatgatcagctcctatgtc
ggcgagaacaagctgttcgaagcgcagtatctggccggcgagctggaactggaactcacc
ccgcagggcaccctcgccgagcgcatccgcgccgggggcgccggcattcctgccttctac
acgaagaccggcgtcggcacgctggtcgcgcagggcaagccgaccgagttcttcgacggc
gaggaatatgtgcgcgagacctggctgcgcgccgatctctcgatcgtcaaggcatggcgg
gcggatacggcgggcaatctcatgttccgcaagaccgcgcgcaacttcaatcccaacatg
gccacggcaggccgggtgacggtggcggaagtcgaggagatcgtgcctgcaggcacgttc
gatccggactgcatccacacccccggcatctatgtcgaccgcatcgtgctgaatacgatc
aacgagaaacgcatcgagaagcgcaccacgcgcccccgcgaggtcgcatga

DBGET integrated database retrieval system