KEGG   Sphingobium sp. SYK-6: SLG_30350
Entry
SLG_30350         CDS       T01622                                 
Name
(GenBank) conjugal transfer protein TrbE
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
ssy02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ssy00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SLG_30350
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ssy02044]
    SLG_30350
Enzymes [BR:ssy01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     SLG_30350
Secretion system [BR:ssy02044]
 Type IV secretion system
  Trb secretion system protein
   SLG_30350
SSDB
Motif
Pfam: P-loop_TraG CagE_TrbE_VirB AAA_10 AAA_22 TraG-D_C ABC_tran AAA_29 AAA_16 TrwB_AAD_bind DUF87 FtsK_SpoIIIE AAA_23 HerA_C
Other DBs
NCBI-ProteinID: BAK67710
NITE: SLG_30350
UniProt: G2ILW7
Position
complement(3280580..3283036)
AA seq 818 aa
MMSLREYRNRAAHLADFLPWAALVGEGVVLNKDGSFQRSAWLRGPDLDSATPAELVATTA
RLNNALRRLGSGWAIFVEAQRTPALDYPESAFPDPVSALVDMERREQFREEGAHFESAYY
LTLLWMPPAEEAARAEGWLYEGRSTTGVDPWELLKGFADRSDRVLNLVEGFVPEVRWLDD
AETLTYLHSTISTRRQRVRVPETPMHLDALLADEPLTGGLEPRLGDHHLRTLTVVGFPSV
TFPGLLDELNRLAFEYRWSTRALMLDKTDATKLLTRIRRQWFAKRKSVAAILKEVMTNEA
STLLDSDASNKAADADTALQELGADYAGMAYVTATVTVWDRDPAIAAEKLRLVEKVIQGR
DFTVIPEGMNAIEAWLGSLPGHTYANVRQPPISTINLAHLIPLSAVWAGPERDEHFGQPP
LLYGRTEGSTPFRFSLHPDGSDVGHTLIVGPTGAGKSVLLALMAMQFRRYENAQVFAFDF
GGSIRAAAIACGGDWQDLGGGLSDDSDGGVQLQPLAHIDDPAERAWAAEWLAAILASEGV
AVDPQAKEHIWSALGSLASAPPAERTLTGLAVLLQSQQLKQALAPYCIGGPWGRLLDAEA
ERLGESDMQAFETEGLVGAGSAAAVLSYLFHRIEGRLDGSPTLIIIDEGWLVLDSPDFAA
QLREWLKTLRKRNASVVFATQSLADIETSSIAPAIIESCPTRIFLPNERAAEPQIAAIYE
RFGLNARQIEILSRATPKRDYYCQSRRGNRLFELGLGEVALTFAAASSKTDQLAIAEIIE
THGQVGFAAEWLRHRGCAWAVELLPSDPQRQPQQELPL
NT seq 2457 nt   +upstreamnt  +downstreamnt
atgatgagcctgcgcgaatacaggaaccgcgccgcccacctggccgatttcctgccctgg
gccgcgttggtcggcgagggcgtcgttctcaacaaggacggctcgttccagcgctcggcg
tggcttcgcggccccgatctcgacagcgccacgccggccgagctggtcgccaccacggcg
cggctcaacaatgcgctgcgccggctgggctcgggttgggcgatcttcgtcgaggcgcag
cgcacgcccgcgctcgactacccggaatcggcattccccgatccggtttccgcgctggtc
gatatggagcggcgcgaacagttccgcgaggaaggcgcccacttcgagagcgcctattat
ctcacgctgctgtggatgccgccggccgaggaagccgcgcgcgccgagggctggctctac
gagggccgctcgaccaccggcgtcgatccgtgggagctgctcaagggcttcgccgatcgc
agcgaccgggttctcaatctggtcgagggcttcgtgcccgaggtccgctggctcgatgac
gccgagacgctgacctatctgcacagcacgatctcgacccgccgccagcgcgtccgcgtc
cccgagacgccgatgcacctggacgcgctgcttgccgacgagccgctgaccggcgggctc
gaaccgcgcctgggcgatcatcatctccgcacgctgacggttgtgggattccccagcgtc
acgttccccggcctgctcgacgagctgaaccggctcgccttcgagtatcgctggtccacc
cgcgcgctgatgctcgacaagaccgacgcgaccaagctgctgaccaggatcaggcggcaa
tggttcgcaaagcgcaaatcggtcgcggcgatcctcaaggaagtcatgaccaacgaggcg
tccacgctgctcgacagcgacgcctcgaacaaggcggccgacgccgatacggcgctccaa
gaactcggcgccgactatgccggcatggcctacgtcaccgctacggtgacggtgtgggac
cgtgatcccgccatcgccgccgagaagctgcggctggtcgagaaggtcatccagggccgc
gacttcaccgtgatccccgaggggatgaacgcgatcgaggcatggcttggaagcctgccc
ggccacacctacgccaacgtccggcaaccgccgatctccaccatcaatctcgcccacctg
atccccctctcagcagtatgggcggggccggaacgggacgagcacttcggacaacccccc
ttgctctatggcaggaccgaaggctcgaccccgttccggttttcccttcaccccgacggt
agcgatgtcgggcacacgctgatcgtcggcccgaccggcgcgggcaagtcggtgctgctc
gcgctgatggcgatgcagttccgccgctacgagaacgcccaggtcttcgccttcgacttc
ggcggctcgatccgtgcggccgccatcgcctgtggcggggattggcaggatctcggcggc
gggctgtccgacgacagcgacggcggcgtccagttgcagccgctcgcccatatcgacgat
ccggccgaacgcgcctgggcggccgaatggctggcggcgatcctcgccagcgaaggcgtc
gcggtcgatccgcaagccaaggagcatatctggtcggcgctgggctcgctcgccagcgcg
ccgccggccgaacggacgctgacagggctcgcggtcctgttgcagagccagcagctcaag
caggcgctcgcgccctattgcatcggcgggccgtggggccggctgctcgacgccgaggcc
gagaggctgggcgagtccgacatgcaagccttcgagaccgagggcctggtcggcgccggc
tcggccgcggcggtgctgtcctacctgttccaccggatcgaagggcggctggacggttcg
ccgacgctcatcatcatcgacgagggctggcttgtcctcgatagcccggacttcgccgcg
cagctccgcgagtggttgaagaccctgcgcaagcgcaacgccagcgtcgtcttcgcgacg
cagagtctcgccgatatcgagacgtcgagcatcgcgccggccatcatcgagtcctgcccg
acgcgcatcttcctgccgaacgagcgcgcggccgaaccgcagatcgcggccatctacgag
cggttcgggctcaacgcccggcagatcgaaatcctcagccgggcgacgcccaagcgggat
tattactgtcaaagcaggcggggcaatcgcctgttcgagctggggctgggcgaggttgcg
ctgaccttcgccgccgcgtcgtcgaagaccgaccagctcgccatcgccgaaatcatcgag
acccacggccaggtcgggttcgcggccgaatggctgcgccatcgcggctgcgcctgggcc
gtcgagcttcttccctccgatcctcaacgccaacctcagcaggagctacctctatga

DBGET integrated database retrieval system