KEGG   Sphingobium sp. SYK-6: SLG_38980Help
Entry
SLG_38980         CDS       T01622                                 

Gene name
ltaA
Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
ssy00260  Glycine, serine and threonine metabolism
ssy01100  Metabolic pathways
ssy01110  Biosynthesis of secondary metabolites
ssy01120  Microbial metabolism in diverse environments
ssy01130  Biosynthesis of antibiotics
ssy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ssy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SLG_38980 (ltaA)
Enzymes [BR:ssy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     SLG_38980 (ltaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: BAK68573
NITE: SLG_38980
UniProt: G2IS18
Position
complement(4185452..4186453)
Genome map
AA seq 333 aa AA seqDB search
MQFFSDNAAPVHPALLAAMEAANGVDTAYDGDALSQGLDARFSALFERDVAVIWTSTGTS
ANALALALLCPPYGGVLTHEDAHIVADECGAVELQTGGARLMTCRAEGGKLSAQSLRERM
AQVRRDVHQVQPHAVSLTNATEYGRVYTPDELAAIGAFCREHGLALHMDGARFANAIASR
DCAPADVTWRAGVDALSFGFTKNGALNAEALILFDPARADEARRRRKRAGHLLSKGRFIA
AQLHAMLEGELWLANARAANAAATILAQAAGERLLHPVEANELFLRLSADEAARLRGQGF
AFYDWGAGAARLVTSWHQGEAEVAPLAAALSAL
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcagttcttttccgacaatgcagcccctgtccatcccgcgcttctggcggcgatggag
gccgccaatggcgtggataccgcttatgatggcgacgcgctcagccaagggctcgacgcg
cgtttttcagcgctgttcgaacgggacgtggcggtcatctggacctcgacggggacgtcc
gccaatgcgcttgcgcttgcgctgctgtgccccccttatggcggggtgctgacgcatgag
gacgcgcatatcgtcgcggatgaatgcggtgccgtggaactgcagaccggtggcgcgcgg
ctgatgacctgccgcgccgagggtggaaaactctcggcgcagagcctgcgcgagcggatg
gcgcaggtccgcagggacgtgcatcaggtccagccgcatgcggtctcgctcaccaatgcc
acggaatatggccgggtctacacgcccgacgagctggcggcgatcggcgccttctgccgc
gagcatgggctggcgctacacatggacggcgcgcgcttcgccaatgcgatcgcaagccgc
gattgcgcgcccgcggacgtcacgtggcgcgcgggcgtggatgccttgagcttcggcttc
accaagaatggcgcgctcaacgcggaagcgctgatcctcttcgatcccgcccgggcggac
gaggcccggcggcggcgcaagcgggccggccatctgctttccaagggccggttcattgcc
gcccagcttcacgccatgctggagggcgagttgtggctggcgaacgcgcgcgccgccaat
gccgccgcgaccattctggcgcaggcggcgggcgagcggctgctccatcccgtcgaggcg
aacgagctgtttctgcgtctctcggcggacgaggccgcccggctgcgcgggcagggcttc
gccttctacgactggggggccggcgccgcgcggctggtcacgagctggcatcagggcgag
gccgaggtggcgccgctcgccgccgcgctctccgctctgtga

DBGET integrated database retrieval system