KEGG   Sphingobium sp. SYK-6: SLG_p_01060
Entry
SLG_p_01060       CDS       T01622                                 
Symbol
virB5
Name
(GenBank) type IV secretory pathway VirB5 component
  KO
K03200  type IV secretion system protein VirB5
Organism
ssy  Sphingobium sp. SYK-6
Pathway
ssy03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ssy00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SLG_p_01060 (virB5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ssy02044]
    SLG_p_01060 (virB5)
Secretion system [BR:ssy02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   SLG_p_01060 (virB5)
SSDB
Motif
Pfam: T4SS
Other DBs
NCBI-ProteinID: BAK68694
NITE: SLG_p_01060
UniProt: G2IU19
Position
pSLPG:100064..100777
AA seq 237 aa
MGKGIYAALGAIALGMAGPAVAQGIPVYDSSGYLQALATVKNTLSMIDQGKEQIAEAKQL
YGSFNQVTDVNGIASSLSTDAMRHLLPREARDISRLMSSDNASLGSLGSSATRIRDANRI
ALPELRPGASAYERASRDNLLRNGDLAARDAAIAEAAYGVSAQRTAGLEELRTSLDTASD
AKQVMDIQARVGVENAHIQNDALQLQALRMRQEADVQLRSQRESEAILATKLESLSQ
NT seq 714 nt   +upstreamnt  +downstreamnt
atgggtaagggcatatacgcagcacttggcgccatcgcccttggaatggcggggcctgca
gtcgcgcaaggtatccccgtctacgacagctccggctatctgcaggcgctggccacggtg
aagaacaccctgtcgatgatcgatcaggggaaggagcagatcgcagaagcgaagcagctc
tatggcagcttcaaccaggtcaccgacgtcaacggcatcgcatcatctctttccaccgat
gccatgcgccaccttctgccgcgggaggcccgtgacatcagccggctgatgtcgtcggac
aatgccagcctgggctcgctcgggagctccgcgacccgtatccgggacgccaaccgtatc
gctttgccggaattgcgaccaggtgcgtcggcgtatgagcgcgcttcccgcgacaacctc
ttgcggaacggcgacctcgcagcgcgcgatgccgcgatcgcggaggcggcctatggcgtg
tcggcccagcgtaccgccgggctcgaagaactgagaacctcgctggatacggcttcggac
gccaagcaggtcatggatatccaggcgagggtaggggtcgagaatgcccatatccagaac
gacgccttgcaattgcaggcgctgcgaatgcggcaagaagcagacgtccagttgcgatca
cagcgcgaaagcgaagcgatactggcgacgaagctagaaagcttgtcgcaatga

DBGET integrated database retrieval system