KEGG   Spiroplasma syrphidicola: SSYRP_v1c02200Help
Entry
SSYRP_v1c02200    CDS       T02677                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
ssyr  Spiroplasma syrphidicola
Pathway
ssyr03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ssyr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SSYRP_v1c02200 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ssyr03011]
    SSYRP_v1c02200 (rplV)
Ribosome [BR:ssyr03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SSYRP_v1c02200 (rplV)
  Bacteria
    SSYRP_v1c02200 (rplV)
  Archaea
    SSYRP_v1c02200 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 16153327
NCBI-ProteinID: AGM25816
UniProt: R4UKL7
Position
244454..244792
Genome map
AA seq 112 aa AA seqDB search
MEVKAHLRSIRISPRKVRLVTDLIRNKKVGEAIVILNNINKKSSLPVQKLVKSAVANAVN
NNGLDADKLFIKEIFVNEGPTLKRFRPRAHGRAYEILKRTSHVTITVSDGQK
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggaagtaaaagcacatttaagaagtattagaatttctcctcgtaaagtcagattggtt
accgatttaatccgaaataaaaaagtgggagaagcaatagttatcttgaacaatatcaat
aaaaaatcatcattaccagttcaaaaattggtaaaatcagctgttgcaaatgcagttaat
aataacggtttagacgctgataaattatttattaaagaaatcttcgttaacgaaggacca
acattaaaaagattccgtccacgagcacacggaagagcatacgaaattttaaaacgaaca
agtcacgtgacaattacggtcagtgacgggcagaaataa

DBGET integrated database retrieval system