KEGG   Serratia symbiotica: SCc_199Help
Entry
SCc_199           CDS       T01672                                 

Definition
(GenBank) exodeoxyribonuclease V, a chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ssz  Serratia symbiotica
Pathway
ssz03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ssz00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SCc_199
Enzymes [BR:ssz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SCc_199
DNA repair and recombination proteins [BR:ssz03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SCc_199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 Helicase_RecD UvrD_C_2 Viral_helicase1 AAA_11 UvrD-helicase AAA_22 AAA_16 DUF2075 AAA_28 T2SSE PhoH IstB_IS21 FtsK_SpoIIIE UvrD_C CbiA AAA_24 SRP54 TrwB_AAD_bind ATPase NACHT MukB NTPase_1 Zeta_toxin Flavi_DEAD AAA
Motif
Other DBs
NCBI-ProteinID: AEW44372
UniProt: R4HZZ0
Position
394055..395902
Genome map
AA seq 615 aa AA seqDB search
MITLLNRAVGLGVLRPLDIQFANIVATEDQPDIFLAAACVSAEVGIGNVCLMLDQMRMGQ
LFTGLPPQLAKAIWLEAGQPDIAQWRRRLITCSAVSNGSSAAPLVLQGERLYLQRMWQSE
GEVAAFFSSSDEYKLVDDSELRNVLDQLFIPTNGKLDWQKIAAAVAVTRRIVVISGGPGT
GKTTTVTKLLAALIQLHKCMHLRIALAAPTGKAATRLTESLANAVCKLDLTPAQYAQFPT
EATTLHRLLGMQFNSQRIYDRYDNKLDLDVLVVDEASMIDLSMMARLIRALPKYTRVIFL
GDRNQLSSVEPGAVFGDICSFSEQGYSKSRAAELSSLSGYVLRGQQVQVESLVRDSLCLL
RKNYRFDAKSGIAQLARAVNVGDIALAVKVLSGGFRDVMDYSLATTEEYQALLVMCVAGY
QNYMEQVIVRDDAITILKTFSSFQVLCALRTGLFGVDGLNQQIELELRRSNLIQSTQGNW
YLGRPIMIERNDSVLGLYNGDIGITLETGRGKLGVYFLLPNGGIKLVQPNRLPAHKTAYA
ITVHKSQGSEFDHIALVLPNYFLSLLTRELIYTAITRARTCVSLYSVRAVLIRAICTRTW
RCSGLIERLRAGNKR
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgataactttattaaatcgggcagttgggcttggtgtgttgaggcctttagatattcag
ttcgctaatatagttgcaacagaggatcagcctgatattttcctggctgctgcttgcgta
agtgcggaggtaggtattggtaatgtttgcttgatgttagatcagatgaggatggggcaa
ttgtttacaggattgccgccgcagttggcaaaagctatctggttagaagctgggcagcca
gatatagcccaatggcgccgtcgccttattacatgcagtgcagttagtaacggcagtagt
gctgctcctctggtattgcaaggtgagcgtctgtacttacagcgtatgtggcagagtgaa
ggtgaggtagcggcattttttagtagttcagacgagtataagttagtggatgattctgag
ttacgcaatgttctcgatcagttatttatcccgactaacggtaaactagattggcagaaa
attgccgctgcagttgcggtaacccggcgcattgtagtgatttccggcggcccaggaact
ggtaaaactacaactgtgactaaattattagctgcattaatacagctgcataagtgtatg
catttacgtattgcattagcggcaccaacaggtaaagcagctacgcgactgacggagtct
cttgctaatgcggtttgtaagctagatttaaccccagcgcagtatgcacaattccctact
gaagctacaacattgcatcgactattgggtatgcagtttaacagccagcgtatctatgat
cgttatgataacaagttggatttagacgtgcttgtggtagatgaggcatcaatgattgat
ttatcaatgatggcacggttaattcgcgctttgccaaaatatacccgagtgatttttctt
ggtgaccgtaatcagttatcttcggtagaacctggcgcggtatttggtgatatttgtagt
tttagtgaacagggttacagtaaaagtcgtgctgcagagttaagtagtttaagtgggtat
gtattacgggggcaacaggtacaggtagaatcattggttcgcgatagcttatgcttgtta
cgcaagaattatcgatttgacgctaaatctggcattgctcagttagcgcgcgcagtcaat
gtgggtgatatagcactagcagttaaagtacttagtggtggttttagagatgttatggat
tattctctggctacaactgaagagtatcaagcgctattagtaatgtgtgttgcgggttat
caaaattatatggagcaagtcatcgttcgggatgatgctatcacaatattaaaaacattt
agtagttttcaggtattatgtgcactgcgtacaggattatttggtgttgatggattaaat
cagcagattgagcttgaattaaggcgctctaacttaattcagagtacgcaggggaattgg
tatctagggcgaccaatcatgattgagcgtaacgatagtgtgctggggttatataatggt
gatattggcattactctagaaactgggcgtggtaagttaggtgtttattttcttttgccg
aatggcggaattaagttagtgcaaccaaatcgtttacccgcgcacaaaactgcttatgcg
ataactgtgcataaatctcagggttctgaatttgatcatatagcgttagtattgccgaac
tattttctatccttactgactcgtgaattaatatatactgctattactcgcgcgcgtaca
tgcgtgtcattgtattcggttagagcagttttgataagggctatttgtacacgcacttgg
cgttgcagtggcctaattgaacgtttacgagccggtaacaaaagatag

DBGET integrated database retrieval system