KEGG   Serratia symbiotica: SCc_296Help
Entry
SCc_296           CDS       T01672                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ssz  Serratia symbiotica
Pathway
ssz00010  Glycolysis / Gluconeogenesis
ssz00260  Glycine, serine and threonine metabolism
ssz00680  Methane metabolism
ssz01100  Metabolic pathways
ssz01110  Biosynthesis of secondary metabolites
ssz01120  Microbial metabolism in diverse environments
ssz01130  Biosynthesis of antibiotics
ssz01200  Carbon metabolism
ssz01230  Biosynthesis of amino acids
Module
ssz_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ssz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCc_296 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    SCc_296 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCc_296 (gpmA)
Enzymes [BR:ssz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SCc_296 (gpmA)
Membrane trafficking [BR:ssz04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SCc_296 (gpmA)
Exosome [BR:ssz04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SCc_296 (gpmA)
  Exosomal proteins of melanoma cells
   SCc_296 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 MAF_flag10
Motif
Other DBs
NCBI-ProteinID: AEW44458
UniProt: R4I1C5
Position
complement(595535..596287)
Genome map
AA seq 250 aa AA seqDB search
MAATKLVMVRHGESQWNYENRFTGWHDVDLSDKGHAEAQDAGNLLQKKGFSFDFAYTSVL
KRAIHTLWHILDALDQTWLPSEKSWRLNERHYGALQGLNKAETAKKYGNEQVKQWRRSFT
ALPPKLTTEDERYPGHDPRYNMLARHKLPLSESLALTINRVIPYWDAEILPKLKNNERII
IVAHGNSLRALIKYLDNLNEKEILELNIPTGIPLVYEFDNAFKPRNHYYLGSAAEIAAKS
AAVAAQGTDE
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaactaagcttgtcatggtacgacatggtgaaagccaatggaattatgaaaat
cgctttactggttggcatgatgttgatttatctgataaaggccatgctgaagcacaagac
gcgggtaatttattacaaaaaaaaggcttttcttttgactttgcatatacttctgtctta
aaacgtgcaatccacactttatggcatatcctcgatgcactagaccaaacctggctacct
agtgaaaaatcatggagactaaatgagcgtcattatggagccctacaaggcttaaataaa
gcagaaactgctaagaaatatggtaatgaacaagttaaacaatggcgtcgtagctttact
gcacttccgcccaaattaactacagaagacgaacgctatccaggtcacgaccctcgatac
aatatgctagctagacacaaacttccgttatccgaaagcttagcactaactattaaccgc
gttattccatactgggacgcagagattttaccaaaacttaagaacaacgagcgcattata
attgtagctcacggcaactctctacgagcactaataaaatacctagataacttaaatgaa
aaagagatattggaattaaatattccaactggaataccattagtgtatgaatttgataac
gcttttaagccaaggaatcattactacttaggtagtgctgccgagatcgcagctaaatca
gctgccgtagcagcccaaggcacagatgaataa

DBGET integrated database retrieval system