KEGG   Serratia symbiotica: SCc_380Help
Entry
SCc_380           CDS       T01672                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ssz  Serratia symbiotica
Pathway
ssz00260  Glycine, serine and threonine metabolism
ssz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ssz01100  Metabolic pathways
ssz01110  Biosynthesis of secondary metabolites
ssz01130  Biosynthesis of antibiotics
ssz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ssz00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCc_380 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCc_380 (trpA)
Enzymes [BR:ssz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SCc_380 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA NMO His_biosynth
Motif
Other DBs
NCBI-ProteinID: AEW44532
UniProt: R4I0F8
Position
821145..821948
Genome map
AA seq 267 aa AA seqDB search
MDRYQTLFKRLENNKEGAFVPFVMLGDPDQDLSLKIIDTLIESGADALELGIPFSDPLAD
GPEIQGASMRALVTGATPDHSFELLILIRQKYPDIPIGLLVYANLVFNNGIDVFYQRCAN
VDIDSVLIADVPFEESAPFRVDAVRNSIASIFICPPNADDDLLHKISLYGGGYTYLLSRA
GVTGTEIRGQLPRRSLINKLRAYHAPPPLQGFGISDSSQINGALQAGAVGVILGSAIVKI
IRQNQADPVQMLVKLADFVRTMKYATL
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggatcgttatcagacattatttaaacgcttagagaataataaggaaggtgctttcgta
ccatttgttatgctaggtgatcctgatcaagatctatcattaaaaattattgatacgtta
attgaatcgggcgcagatgcactagaactaggtattcctttttctgacccgctcgcagat
ggcccagagattcaaggagcatcaatgcgtgcgcttgttactggcgcaacaccagatcat
agttttgaactattgatattaattcgacaaaaatatccagatattccgattggattatta
gtatatgctaatcttgtattcaataatggtattgatgtattttatcaacgctgcgctaat
gtagatatagactctgtacttattgctgatgtgccttttgaagaatctgcgccattccgt
gttgacgcagtaagaaatagtattgcatcaatctttatatgtccgcctaatgctgatgat
gatttgctgcataaaatttctctctatggaggtggctatacttacttattatcacgtgct
ggcgtgactggtactgaaatacgaggccaattaccaagacgtagccttattaataaacta
cgtgcatatcatgcgcccccaccacttcagggatttgggatctcagattcttctcaaata
aatggcgcattacaggctggtgctgtaggagtgatcctaggttctgcaattgttaagatt
attaggcagaatcaagctgatccagttcagatgttagttaaattggctgattttgtgcgt
acgatgaaatatgctactctataa

DBGET integrated database retrieval system