KEGG   Spirochaeta thermophila DSM 6192: STHERM_c13550Help
Entry
STHERM_c13550     CDS       T01315                                 

Definition
(GenBank) hypothetical protein
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
sta  Spirochaeta thermophila DSM 6192
Pathway
sta00860  Porphyrin and chlorophyll metabolism
sta01100  Metabolic pathways
sta01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sta00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    STHERM_c13550
Enzymes [BR:sta01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     STHERM_c13550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 Sigma54_activat MCM AAA AAA_16 AAA_22 AAA_32 AAA_29 Viral_helicase1 DUF815 TIP49 AAA_2 AAA_28 AAA_18 TsaE AAA_3 ABC_tran AAA_23 NACHT Sigma54_activ_2 PduV-EutP AAA_24
Motif
Other DBs
NCBI-ProteinID: ADN02295
UniProt: E0RU74
Position
complement(1470587..1471618)
Genome map
AA seq 343 aa AA seqDB search
MGPIFPFSAIVGQEEAKQALLLGVIDPGIGGVLLFGEKGTGKTTLVRALASLVPGMPLVE
LPLNATEDRLVGSLNVEKALSEGVRQFEPGLLAAAHGGILYVDEVNLLEHHLVDLLLDVA
ATGVNRVEREGISYEHPARFLLVGSMNPEEGDLRPQFLDRFGLAVPVRHLEDPDLRAEVV
RRRLAFESDPEGFVRAWREEDALASQVAVARERLRRVGVAEEVYAEAVRIAGVLGARGHR
AELVMVRAARALAAFLERDEADTALVRAVARYALVHRVRIGPGEREDAVLRRIDAAVEGR
EGEREVEGEMVEPEDAVVPGAAAAGSLMFEFVKKKLTRWSTSR
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgggtcccatcttcccgttttccgcgatcgtggggcaggaagaggcgaagcaggcgctc
ctcctgggggtgatcgatccggggatcgggggggtgctcctcttcggggagaaggggacg
ggtaagaccacgttggtgagggccctcgcctcgctcgtgccggggatgccgctggtggag
cttcccctcaatgccaccgaggacaggctggtggggtcgctcaacgtggagaaggccctc
tccgagggggtgcgccagttcgagccggggctcctcgctgcagcgcacggggggatcctc
tatgtggacgaggtgaacctgctggagcaccacctggtggacctgctcctggatgtggcg
gcgacgggggtgaatcgtgtggagcgggaggggatctcctacgagcatcccgcccggttc
ctcctcgtgggttcgatgaatccggaggagggggatctccgtccgcagttcctcgaccgt
ttcggtctcgcggtgccggtgcggcatcttgaggatccggacctgcgggccgaggtggtg
cgccggcggctcgccttcgagtccgatcccgaggggtttgtgcgtgcgtggcgggaggag
gatgcgctcgcctcccaggtggcggtggcgcgggagcggctgaggagggtgggggtggct
gaggaggtgtatgccgaggcggtacggatcgccggcgtgctcggggcgcgggggcatcgg
gccgagctggtgatggtgcgggcggcgagggcgctcgcggcgtttctcgagcgggatgag
gcggatacggcgctggtgcgggcggtggcgcggtatgcgctcgtgcacagggttcggatc
gggccgggcgagcgtgaggatgcggtgctccgaaggatcgatgcggcggtggaggggcgg
gagggggagcgggaggtggagggggagatggtggagccggaggatgcggtggtgccgggg
gctgcggcggcaggttcgctcatgttcgagttcgttaaaaaaaaactgacgaggtggtcc
acgagccggtag

DBGET integrated database retrieval system