KEGG   Spirochaeta thermophila DSM 6192: STHERM_c18760Help
Entry
STHERM_c18760     CDS       T01315                                 

Definition
(GenBank) tryptophan synthase beta chain 2
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sta  Spirochaeta thermophila DSM 6192
Pathway
sta00260  Glycine, serine and threonine metabolism
sta00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sta01100  Metabolic pathways
sta01110  Biosynthesis of secondary metabolites
sta01130  Biosynthesis of antibiotics
sta01230  Biosynthesis of amino acids
Module
sta_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sta00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STHERM_c18760
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    STHERM_c18760
Enzymes [BR:sta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     STHERM_c18760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADN02811
UniProt: E0RPV8
Position
complement(2057299..2058651)
Genome map
AA seq 450 aa AA seqDB search
MQRKILLSEKDLPSHWYNILADLPGGPLDPPLHPVTKQPLAPDELSALFPRALIEQEMSG
ERWIEIPEEVRKILALWRPTPLYRAYQLEQALGTPARIYFKWEGASPPGSHKSNTSVAQA
YYNRKEGITRLTTETGAGQWGSSLAFAGRLFGMEVRVYMVKVSYEGKPYRRIMMETWGAE
CIPSPSPRTKVGKAILEKDPDSPGSLGIAISEAVEEAVEREDTHYALGSVLNHVLLHQTV
IGLECKKQLELAGDYPDVVIGCVGGGSNFGGIALPFAYDKIHGKDVRLVAVEPSACPTLT
KGVYTYDYGDTGKMTPIVRMHTLGHDFVPPGIHAGGLRYHGMAPIVSRLVKEGVVEARAY
HQRAVFEAAVLFARTEGFIVAPETAHAIKACVDEALAAKEEGKERVILVNASGHGHFDMA
AYQQYFEGRLEDYEYPEEKIREALSALPRI
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagaaaaatcctgctcagtgaaaaggatcttccctcgcactggtacaacatcctc
gcggatctgccgggcgggccgctcgacccgcccctccatccggtcacgaagcagccgctc
gcgccggatgaactctccgccctcttcccccgggccctcatcgaacaggagatgagcggc
gagcggtggatcgaaattcccgaggaagtgcggaagatcctcgccctctggcggcccacg
ccgctctaccgggcctaccagctggaacaggccctcgggaccccggctcgtatctacttc
aagtgggagggtgcctctcctccgggttcccacaagtccaatacctcggtggcccaggcc
tactacaacaggaaggaagggatcaccaggctcaccacggagacgggggcgggccagtgg
gggagcagcctcgccttcgcgggcaggctcttcgggatggaggtgcgggtctacatggtg
aaggtgagctacgagggcaagccctacaggcgcatcatgatggagacgtggggcgccgag
tgcatacccagtccctcaccccgcaccaaggtgggcaaggccatcctcgagaaggatccc
gactcgcccggttccctcggtatcgccataagcgaggccgtggaggaggcggtggaacgg
gaggacacccactacgccctcggttcggtcctcaaccatgtgctgctccatcagacggtg
atcggcctcgagtgcaagaaacagctcgagctcgcgggtgactatcccgatgtggtcata
ggctgtgtgggtgggggatcgaacttcgggggtatcgcccttcccttcgcctacgacaag
atccatgggaaggacgtgcgcctcgtggcggtggagccttcggcgtgtcccaccctcacc
aagggcgtctatacgtacgactacggcgacacggggaagatgacccccatcgtcaggatg
cacaccctggggcacgacttcgtcccgccgggcatccatgcaggaggcctgcggtatcac
ggcatggcgcccatcgtctcgcgtctggtgaaggagggggtggtcgaggcccgtgcctac
catcagagggcggtcttcgaggccgcggtcctcttcgcccgcaccgaggggttcatcgtg
gcgcccgagacggcccatgcgatcaaggcctgcgtggacgaggccctcgcggcgaaggaa
gaagggaaggagcgggtcatcctggtgaacgcatcgggtcacgggcacttcgacatggcg
gcctaccagcagtacttcgagggcaggctcgaggattacgagtatcccgaggagaagatc
agggaggcactctcggcgctcccccggatctga

DBGET integrated database retrieval system