KEGG   Stanieria sp. NIES-3757: STA3757_02650Help
Entry
STA3757_02650     CDS       T05130                                 

Definition
(GenBank) light-independent protochlorophyllide reductase, N subunit
  KO
K04038  light-independent protochlorophyllide reductase subunit N [EC:1.3.7.7]
Organism
stan  Stanieria sp. NIES-3757
Pathway
stan00860  Porphyrin and chlorophyll metabolism
stan01100  Metabolic pathways
stan01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:stan00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    STA3757_02650
Enzymes [BR:stan01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     STA3757_02650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_nitro Glyco_trans_1_2
Motif
Other DBs
NCBI-ProteinID: BAU62914
UniProt: A0A140K0N7
Position
complement(293068..294471)
Genome map
AA seq 467 aa AA seqDB search
MTLAQEPTALTFDCETGNYHTFCPISCVAWLYQKIEDSFFLVIGTKTCGYFLQNAMGVMI
FAEPRYAMAELEEADISAQLNDYEELKRLCVQIKRDRNPSVIVWIGTCTTEIIKMDLEGL
APKLEAEIGIPIVTARANGLDYAFTQGEDTVLAAMAHKCPSQAPVAEAEKEERNAISKLL
NFGKKKEETKAEESEYVDHPPLVLFGSLPDPVVTNLTLELKKQGIKVSGWLPAKRFTELP
VIEEGYYTCGVNPFLSRTATTLMRRRKTKLIGAPFPIGPDGTRAWIEKICSVFGIEPQGL
EEREAKIWESLEDYIKLIRGKSVFFMGDNLLEISLARFLIRCGMTCPEIGIPYMDKRYQK
AELDLLEKTCQEMGVPLPKIIEKPDNYNQIQRIYELQPDLVITGMAHANPLEARGINTKW
SVEFTFAQIHGFTNARDILELATRPLRRNNNLKELGWEKLVKEEAQV
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgacactggcacaagaacctacagcattaacttttgattgcgaaactgggaattaccat
accttctgtccaattagctgcgttgcgtggttatatcaaaaaattgaagatagcttcttc
ttagttattggtacaaaaacctgtggttacttcctgcaaaatgcgatgggagtaatgatc
tttgccgaacctcgttacgcgatggcagagttagaagaagcagatatttccgcacaactc
aacgactacgaagaattaaaaagactttgtgtacagattaagcgcgatcgcaatccttct
gttatagtctggattggtacttgtaccaccgaaattattaagatggatttggaaggttta
gcaccgaagttagaagctgaaatcggtattcccatcgttaccgcccgtgctaacggttta
gattacgcctttactcaaggggaagataccgtactcgctgcaatggcacataaatgtcct
tctcaagcacctgtagcagaagcagaaaaagaagaacgtaacgctatttctaaattactc
aactttggtaagaagaaagaagaaaccaaagcagaagaatcggaatatgtggatcatcct
ccgttagtcttattcggttctttacccgatcctgtcgttactaacctcactttagaactg
aaaaaacagggcattaaagtatctggttggttacctgccaaacgttttaccgaattacca
gtgattgaagaaggttattatacttgcggtgttaacccctttctctctcgcaccgctaca
actttaatgcgtcgtcgcaaaactaaactcattggcgcaccctttcctattggtcccgat
ggtactcgtgcttggattgaaaaaatctgttctgtttttggaattgaacctcaaggttta
gaagaaagagaagccaaaatttgggaaagcttggaagattacatcaaattaattcgtggt
aagtcagttttcttcatgggtgacaacttactcgaaatttctttagcacgtttcctgatt
cgttgcggtatgacttgtcctgaaattggcattccctatatggataagcgttatcaaaag
gctgaattagatttattagaaaaaacctgtcaagaaatgggtgttcctctgcccaaaatt
atcgaaaaacccgataactacaatcaaattcaacgtatttatgaattacaaccagattta
gtaattactggtatggcacacgctaatcctttggaagctagaggaattaatactaaatgg
tcggttgagtttacctttgcccaaatacatggttttactaatgccagagatatccttgag
ttagctactcgtccgctacgaagaaataataatttgaaagagttaggttgggagaaatta
gttaaggaagaagcacaagtttaa

DBGET integrated database retrieval system