KEGG   Stanieria sp. NIES-3757: STA3757_20600Help
Entry
STA3757_20600     CDS       T05130                                 

Definition
(GenBank) putative glucose 1-dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
stan  Stanieria sp. NIES-3757
Pathway
stan00030  Pentose phosphate pathway
stan01100  Metabolic pathways
stan01120  Microbial metabolism in diverse environments
stan01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:stan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    STA3757_20600
Enzymes [BR:stan01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     STA3757_20600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase DUF1776 Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: BAU64687
UniProt: A0A140K5R0
Position
2252711..2253520
Genome map
AA seq 269 aa AA seqDB search
MKGLTGKNVLITGATSGIGQAIAVRFVLEGANVALNYRNDPDKLDETKELIEQNCSQVTG
CGGQAIPVEGDVSEPEDVVRMCQEVIEKLGSLDILINNAGFQKASPSHQIELADFDQVIA
VNLRGAYLCATEAIKHFLATKRAGIIINVSSVHEIIPRPQYLSYSISKGGMANMTKTLAL
EYAPQGIRINAIAPGATATPINDWQDDPEQKQEIERHIPMGRVGTSEEMAAITAFLASDE
AAYITGQTLFVDGGLTLYADFLQPWSAGE
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggattaacaggaaaaaatgttttgatcactggtgcaacttctgggattgggcaa
gcgatcgcagttcgttttgttttagaaggtgctaatgtagctcttaattatcgcaatgat
cctgataaacttgatgagactaaagagttaatcgaacagaattgttctcaagttacaggt
tgtggtggtcaagcaattccagtagaaggagatgtttctgaaccagaagatgttgtcaga
atgtgtcaagaagtcattgaaaaattaggtagtttagatattttaattaataatgctggg
tttcaaaaagctagtccttctcatcaaattgaattagctgattttgaccaagtaattgct
gttaatctacgaggtgcttatctttgtgctacagaagcaatcaaacattttttagcaacc
aaacgagccggtattattattaatgtttcttctgttcatgaaattattcctcgtccgcaa
tatctcagctattcaattagtaaaggtggtatggcaaacatgaccaaaactctagcacta
gaatatgccccacaaggaattagaataaatgcgatcgctcctggagcaacggctacacca
attaatgactggcaagatgaccccgaacagaaacaagaaatagaaagacatattccgatg
ggtagagttggtacatcagaagaaatggctgctattactgcatttttggcttctgatgag
gctgcttatatcacaggtcaaactttgtttgttgatggtggtttaactctttatgccgat
tttttacaaccgtggtcggcaggagaataa

DBGET integrated database retrieval system