KEGG   Sphingomonas taxi: MC45_02900Help
Entry
MC45_02900        CDS       T03398                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase [ATP]
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
stax  Sphingomonas taxi
Pathway
stax00010  Glycolysis / Gluconeogenesis
stax00020  Citrate cycle (TCA cycle)
stax00620  Pyruvate metabolism
stax01100  Metabolic pathways
stax01110  Biosynthesis of secondary metabolites
stax01120  Microbial metabolism in diverse environments
stax01130  Biosynthesis of antibiotics
stax01200  Carbon metabolism
Module
stax_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:stax00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MC45_02900
   00020 Citrate cycle (TCA cycle)
    MC45_02900
   00620 Pyruvate metabolism
    MC45_02900
Enzymes [BR:stax01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     MC45_02900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_24 AAA_25
Motif
Other DBs
NCBI-ProteinID: AIT07949
UniProt: A0A097EK55
Position
665656..667263
Genome map
AA seq 535 aa AA seqDB search
MNERIPHAGLASQSIETRADLHWNLVTARLVEAAVARGEGKLSADGPLVVETGAHTGRSA
QDKFIVRDAETEDSVWWGKSNKGMNPAHFAALKADFLAALRDKEHLFVQDLYGGSQPENR
VRVRVVNELAWHNLFIRTMLVRPEEHELQGFVPEYTIIDLPSFRADPARHGTRSETVIAV
NFTEKLILIGGTRYAGEMKKSVFGLLNYLLPKSGVMPMHCSANMGADGSTAVFFGLSGTG
KTTLSADASRTLIGDDEHGWSDTAVFNFEGGCYAKMIRLSPDAEPEIFATTKRFGTVLEN
VVMDPVTRQLDLDDNSLAENSRGAYPIDFIPNASRNNMGGVPKNIVMLTADAYGVLPPIA
KLTPDQAMYHFLSGYTARVAGTEIGVTEPDATFSTCFGAPFMPRHPSVYGNLLKERIAEG
GVDCWLVNTGWTGGKYGVGHRMPIKATRALLNAALDGSLKHGEFRTDPNFGFQVPVEVPG
VDGAILDPRSTWADTAAYDATAAKLVDLFVENFAQFDDHVDAGVRRSAPQVTEAA
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgagcgcattccgcacgcaggtctcgcgagccagtctatcgaaacgagagccgat
ctccactggaacctggtcaccgcgcggctggtcgaggccgcggtcgcccgcggcgagggc
aagctcagcgccgacgggcctttggtcgtcgagaccggcgcgcacaccggccgctcggcg
caggacaagttcatcgtccgcgatgccgagaccgaggacagcgtctggtggggcaagtcc
aacaaggggatgaacccggcgcatttcgccgcgctcaaggccgatttcctcgctgcgctg
cgcgacaaggagcatctgttcgtccaggatctctacggcggttcgcagcccgagaaccgg
gtccgcgtccgcgtcgtcaacgagcttgcctggcacaacctcttcatccgcacgatgctg
gtccggccggaggagcatgagctgcaggggttcgtccccgaatatacgatcatcgatctg
ccgagcttccgcgccgatcccgcccgccacggcacgcgcagcgagacggtgatcgcggtc
aatttcaccgagaagctgatcctgatcggcggcacccgctatgccggcgaaatgaagaag
tcggtgttcggcctgctcaactatctgctgccgaagagcggcgtgatgccgatgcattgc
tcggccaatatgggcgcggacggctcgaccgcggtgttcttcggcctgtccggcaccggc
aagacgacgctcagcgccgatgccagccgcacgctgatcggcgacgacgagcacggctgg
tccgacaccgcggtcttcaatttcgagggcggctgctacgccaagatgatccgcctgtcg
cccgacgccgagccggagatcttcgcgaccaccaagcgcttcggcacggtactcgagaat
gtcgtgatggacccggtcacccgccagctcgacctcgacgacaacagcctcgccgagaac
agccgcggcgcctatccgatcgacttcatccccaatgcctcgcgcaacaatatgggcggg
gtgccgaagaacatcgtgatgctgaccgcggacgcctatggcgtgctgccgccgatcgcc
aagctgacccccgatcaggcgatgtaccatttcctgtcgggttataccgcgcgcgtcgcc
ggcaccgagatcggcgtcaccgaacccgacgccaccttctcgacgtgtttcggcgcgccg
ttcatgccgcggcatccctcggtctacggcaatctgctcaaggagcggatcgccgagggc
ggggtggattgctggctggtcaacaccggctggaccggcggcaaatatggcgtcggtcat
cgcatgccgatcaaggcgacgcgcgcgctgctcaacgcggcgctcgacggcagcctcaag
cacggcgagttccgcaccgatccgaatttcggcttccaggtgccggtcgaggtgccgggc
gtcgacggcgcgatcctcgacccgcgcagcacctgggcggataccgccgcctatgacgcc
accgccgcgaagctcgtcgatctgttcgtcgagaatttcgcgcaattcgacgaccatgtc
gatgccggcgtgcgccgatcagcaccgcaggtgaccgaagcggcgtga

DBGET integrated database retrieval system