KEGG   Sphingomonas taxi: MC45_11045Help
Entry
MC45_11045        CDS       T03398                                 

Definition
(GenBank) phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
stax  Sphingomonas taxi
Pathway
stax00360  Phenylalanine metabolism
stax00400  Phenylalanine, tyrosine and tryptophan biosynthesis
stax00790  Folate biosynthesis
stax01100  Metabolic pathways
stax01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:stax00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    MC45_11045
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MC45_11045
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MC45_11045
Enzymes [BR:stax01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     MC45_11045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AIT06820
UniProt: A0A097EGX1
Position
complement(2430548..2431420)
Genome map
AA seq 290 aa AA seqDB search
MADESHVTETPPAEAAADWTIAQNWQHYTAEEHATWDTLFARQSQLLPGRASDAYLRGLD
VLKLSKPGIPDFAELSERLMKLTGWQVVAVPGLVPDDVFFDHMANRRFVAGNFIRRPDQL
DYLQEPDVFHDVFGHVPMLADPVFADYLEAYGRGGQRALGLDALKYLGRLYWYTVEFGLI
QEGDDLRIYGSGIVSSFAESRFALDDPSPNRIAFDIARVMRTEYRIDDFQQNYFVIPSFE
ELLRVTVETDFAPLYEELKAQEDIPVAAIVAGDRVLTQGTQHYARSKARG
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggcagatgaatcacacgtgaccgaaacgcccccggccgaggccgccgccgactggacg
atcgcccagaactggcagcattataccgccgaggagcatgcgacctgggacaccttgttc
gcgcgccagtcgcaattgctccccgggcgcgcgtccgacgcctatctgcgcgggctcgac
gtgctcaaactgtcgaagccgggcatacccgatttcgccgaattgtccgaacggctgatg
aagctgaccggctggcaggtcgtcgcggtgccggggctggtccccgacgacgtcttcttc
gaccatatggccaaccgccgcttcgtcgcgggcaatttcatccgtcgccccgaccagctc
gactatctgcaggagcccgacgtctttcacgacgtgttcggccacgtgccgatgctcgcc
gatccggtgttcgccgattatctcgaagcctatggccgcggcgggcagcgcgcgctgggg
ctcgatgcgctgaaatatctcgggcggctctattggtacacggtcgagttcggcttgatc
caggagggcgacgacctgcgcatctacggctcgggcatcgtgtcgagcttcgccgaaagc
cgcttcgcgctcgacgatccgagccccaaccgcatcgccttcgacatcgcgcgggtgatg
cgcaccgaatatcggatcgatgatttccagcagaattatttcgtcatcccgagcttcgag
gaattgctgcgcgtcacggtcgagaccgatttcgcgcccttgtacgaggagctgaaagcg
caggaggatatcccggtcgcggcgatcgtcgccggcgaccgcgtgctgactcaaggcacg
cagcattatgcgcggagcaaggcgcgggggtaa

DBGET integrated database retrieval system