KEGG   Sphingomonas taxi: MC45_11825Help
Entry
MC45_11825        CDS       T03398                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
stax  Sphingomonas taxi
Pathway
stax03010  Ribosome
Brite
KEGG Orthology (KO) [BR:stax00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    MC45_11825
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:stax03011]
    MC45_11825
Ribosome [BR:stax03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    MC45_11825
  Bacteria
    MC45_11825
  Archaea
    MC45_11825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Baseplate_J
Motif
Other DBs
NCBI-ProteinID: AIT06955
UniProt: A0A097EHA8
Position
complement(2594253..2594630)
Genome map
AA seq 125 aa AA seqDB search
MSKPVSPRKVGEKEALAVATQIRGSAQKLNLVAALIRNKPVGDAMSILQFSTKAMAIDAR
KVLASAIANAENNHNLDVDALVVAEASVGKSITMKRFATRGRGKSTRILKPFSRLRIVVR
EQEEA
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcctgtatccccccgcaaggtcggcgagaaggaagcgcttgccgtcgcgacg
cagatccgtggttcggcgcagaagctgaacctggtcgcggcgctgatccgcaacaagccg
gtcggcgatgcgatgagcatccttcagttctcgaccaaggcgatggcgatcgacgcgcgc
aaggtgctggcctcggccatcgccaacgccgagaacaaccacaacctcgacgtcgacgcg
ctcgtcgtcgccgaggcctcggtcggcaagtcgatcaccatgaagcgcttcgcgacccgc
ggccgtggcaagtccacccgcatcctgaagccgttcagccgtctgcgcatcgtcgtgcgc
gagcaggaagaagcataa

DBGET integrated database retrieval system