KEGG   Streptococcus pasteurianus: SGPB_0467Help
Entry
SGPB_0467         CDS       T01524                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
stb  Streptococcus pasteurianus
Pathway
stb00010  Glycolysis / Gluconeogenesis
stb00052  Galactose metabolism
stb00500  Starch and sucrose metabolism
stb00520  Amino sugar and nucleotide sugar metabolism
stb00521  Streptomycin biosynthesis
stb01100  Metabolic pathways
stb01110  Biosynthesis of secondary metabolites
stb01120  Microbial metabolism in diverse environments
stb01130  Biosynthesis of antibiotics
stb01200  Carbon metabolism
Module
stb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
stb_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:stb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGPB_0467 (glk)
   00052 Galactose metabolism
    SGPB_0467 (glk)
   00500 Starch and sucrose metabolism
    SGPB_0467 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    SGPB_0467 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SGPB_0467 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SGPB_0467 (glk)
Enzymes [BR:stb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SGPB_0467 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: BAK29581
UniProt: F5X591
Position
486777..487745
Genome map
AA seq 322 aa AA seqDB search
MTKKLLGIDLGGTTIKFGILTLEGEVQEKWAIDTNILEDGKHIVPDIVGSIKHRLNLYGL
TKDDFVGIGMGSPGAVDRAKKTVTGAFNLNWAHTEEVGSVIERELGIPFAIDNDANVAAL
GERWTGAGANNPDVVFVTLGTGVGGGVIADGNLIHGVAGAGGEIGHMNVEPVDGFECTCG
NKGCLETVASATGVVRVARHLAEEYEGDSSIKAAIDNGDAVTSKDIFVAAEAGDHFADSV
VEKVGFYLGQATANIANILNPDSVVIGGGVSAAGEFLRSRVEKYFVSYAFPQVRKTTKIK
IAELGNDAGIIGAASLASQFVD
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaacttttggggattgaccttggtgggacaacgattaaattcggtatccta
acacttgagggagaagtacaagaaaaatgggcaattgatactaatatccttgaagatggt
aaacacattgtccctgatattgttggatcaatcaaacaccgtttgaatctttacggtttg
acaaaagatgattttgtaggtatcggtatggggtctccaggtgctgttgaccgcgctaaa
aaaacagttacaggtgctttcaacttgaactgggcacacactgaagaagtcggttcagtt
atcgaacgtgaacttggcattccatttgctattgataacgatgcaaatgtagctgcactt
ggtgaacgttggacaggtgctggcgcaaacaatccagatgttgtttttgtaacacttgga
actggtgttggtggcggtgttatcgctgacggtaaccttatccatggtgtcgctggtgct
ggtggagaaattggtcacatgaatgttgagccagttgatggatttgaatgtacttgtggt
aacaagggttgcctagaaacagttgcttcagcgacaggtgttgtgcgtgtggctcgtcat
ttggctgaagaatatgaaggtgattcaagcatcaaagctgccattgataatggtgatgcg
gtgacaagtaaagacatctttgtcgctgctgaagcgggtgaccattttgccgattcagtt
gttgaaaaagttggtttctatcttggtcaagcaacagcaaatatcgcaaacatcttaaac
ccagactcagttgttatcggtggtggtgtttcagctgcaggcgaattcttgcgtagtcgc
gttgaaaaatattttgtcagctacgctttcccacaagtgcgcaaaacaacaaaaatcaaa
attgccgaacttggaaatgatgctggtatcattggtgcagcaagtcttgcaagtcaattt
gtagattaa

DBGET integrated database retrieval system