KEGG   Streptococcus pasteurianus: SGPB_0584Help
Entry
SGPB_0584         CDS       T01524                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
stb  Streptococcus pasteurianus
Pathway
stb00020  Citrate cycle (TCA cycle)
stb00480  Glutathione metabolism
stb01100  Metabolic pathways
stb01110  Biosynthesis of secondary metabolites
stb01120  Microbial metabolism in diverse environments
stb01130  Biosynthesis of antibiotics
stb01200  Carbon metabolism
stb01210  2-Oxocarboxylic acid metabolism
stb01230  Biosynthesis of amino acids
Module
stb_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:stb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SGPB_0584 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SGPB_0584 (icd)
Enzymes [BR:stb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SGPB_0584 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: BAK29691
UniProt: F5X5K1
Position
605375..606550
Genome map
AA seq 391 aa AA seqDB search
MADKIILENGHLTVSNNPIIPFIEGDGVGRDIWKNARAVFDAAIDKAYQGQKKVEWLELL
AGKKAHEATGEWLPEATLETIKEDLVAIKGPLETPVGGGIRSLNVALRQELDLYACVRPV
RYFKGIESPLKEPEKTSITIFRENTEDIYAGIEWNAGTEEVKKVIDFLQNEMSVSKIRFP
ETSSIGIKPISQEGSERLIRSAIEYALANNLTKVTLVHKGNIQKFTEGGFRSWGYDLAKR
EYADELASGKLVINDIIADNFLQQILLNPEKFDVVALTNLNGDYASDALAAQVGGIGISP
GANINYLTGHAIFEATHGTAPDIAGKDIANPCSVLLSGCMLFDYIGWTEVASLITAAIEK
TFAQGQFTADLAQEKVACSTSGFAAKLIENL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcagataaaatcattttagaaaatggtcacttgactgtttctaacaatccaattatc
ccttttattgaaggggatggtgttggacgtgacatttggaaaaatgcgcgtgctgtcttt
gatgcagcgattgataaagcttaccaaggtcagaaaaaagttgaatggcttgagcttttg
gctggtaaaaaagcgcatgaagcaacaggagaatggttaccagaagcaactcttgaaacg
attaaagaagatttggtcgctatcaaaggtccgctagaaacaccagttggtggtgggatt
cgttcactaaatgttgcccttcgtcaagaattggatttatacgcttgtgtgcgtcctgtt
cgttattttaaagggattgaaagcccacttaaagaaccagaaaaaacaagcattactatt
ttccgtgaaaatacggaagatatttatgcaggtatcgagtggaatgctggcacagaagaa
gtgaaaaaagtcattgatttcttgcaaaatgaaatgtctgtcagcaagattcgttttcct
gaaacaagtagtatcggaatcaaaccaatctcacaagaaggtagtgaacgtttgattcgc
tctgcgattgaatacgctcttgctaacaatttgactaaagtcactcttgttcacaaagga
aatattcaaaaattcacagaaggtggcttccgtagctggggttatgaccttgcaaaacgt
gaatacgctgacgaattagccagcggaaaattggtgattaatgacattattgctgataat
ttcttgcaacaaattttgcttaatcctgaaaaatttgatgttgtggctttgacaaacctc
aatggtgactatgctagtgatgcccttgctgcccaagttggtggtattggaatctcacca
ggtgccaatatcaactatttaacaggtcacgctatttttgaagcaacacacggaactgca
ccagatattgctggtaaagacattgccaatccatgctctgttcttttgtctggttgcatg
ttgtttgattacattggttggacagaagtagctagtttaatcacagcagcgattgaaaaa
acatttgcacaaggtcaatttacagctgatttggcgcaagaaaaagtagcctgctcaaca
agtggatttgcagcaaagcttattgaaaatttgtaa

DBGET integrated database retrieval system