KEGG   Streptococcus pasteurianus: SGPB_0954Help
Entry
SGPB_0954         CDS       T01524                                 

Gene name
nagZ.2
Definition
(GenBank) beta-N-acetylhexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
stb  Streptococcus pasteurianus
Pathway
stb00520  Amino sugar and nucleotide sugar metabolism
stb01100  Metabolic pathways
stb01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:stb00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SGPB_0954 (nagZ.2)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    SGPB_0954 (nagZ.2)
Enzymes [BR:stb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SGPB_0954 (nagZ.2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: BAK30026
UniProt: F5X6I6
Position
complement(993853..995643)
Genome map
AA seq 596 aa AA seqDB search
MAHLVDLTQKPYCLDAQAITWVESTIASMNLDEKIGQLFVNMGSSRTEEYLTQVLKDYKI
AAVRYNKGKADEIWEQNHILQTKSKIPLLIAANTEAGGDGAVTDGTKIGDEIKIAATNNP
KYAYEMGRIAGIEAAAVGCNVSFAPIVDLTRNWRNPIIANRNWGSNVDQVITLSKEYMKG
IMEQGIMPFAKHFPGDGIDERDHHLSFASNPMTKEEWITTFGRIYGELVDAGLPGIMAGH
IHLPKVEKEMHPERDWDDMLPASLNKTLLDELLRGELGYNGVIVTDASHMVAMTASMPRR
LMLPTAVEAGCDLFLFFNDPEEDLQWMKEGYEAGILTEERLHDALRRTLGLKARLGLHLF
EGRREEIMLPKEEALSLINTKESQAIADEVADKAITLVKDKQKDILPVTPDRYKRILIVN
VEGHKGGFGAMIAGQKKRASNVVKDLLQARGHDVTVWESTEERIMQLPENERAAAIANVY
AQKQPISNLTDHYDLILNLVDVNSGGTVQRIVWPAAKGTPDQPFYVHEIPTIVVSVQHAF
ALADMPQVGTYINAYDGKDNTMKYLVEKLAGESTFTGVSPVDAFCGLIDTHLWREY
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atggcacatttagtagatttaacacaaaaaccctattgcttagatgctcaagccattaca
tgggtcgaatcaaccatagcttctatgaacttagatgaaaaaattggtcaactttttgtc
aatatgggatctagtcgcacagaagagtatttgacgcaggtattgaaagattataagatt
gctgccgttcgttacaataaagggaaggctgatgaaatttgggaacaaaaccatatttta
caaactaagtcaaaaatccctttgttaatagctgctaatacagaggctggtggagatggt
gctgttactgatggtaccaaaattggagatgaaattaagattgctgccaccaacaatcca
aaatatgcttatgaaatgggacgtatagcaggtattgaagcggcagcagttggttgtaat
gtatcatttgcacctatagttgatttaacacgcaactggcgtaacccaattatcgctaat
cgtaactggggatccaatgtagaccaagttattaccttgtcaaaagaatatatgaaagga
atcatggagcaggggattatgccatttgccaaacatttcccaggagacggaattgacgaa
cgtgatcatcatttgtcttttgcttcaaatccaatgactaaggaagagtggataactact
tttggtcgtatttatggcgaactggttgatgcaggacttcctggtattatggcaggacat
attcatttgccaaaagtggaaaaagaaatgcaccctgaacgagattgggatgatatgttg
cctgcctcactcaataagactctgctagatgaattattacgtggcgaacttggttacaac
ggagttattgtgacagacgcctcacacatggttgctatgacagcttctatgccacgtcgt
ctcatgttaccaacagctgtagaagcaggttgtgatctctttctattctttaacgaccca
gaagaagatttacaatggatgaaagaaggatatgaagcgggtattcttactgaagaaagg
ttacatgatgcccttcgacgcacccttggtttgaaagcacgtttgggactacatttattt
gaagggcgccgtgaggaaattatgttaccaaaagaagaagcgctatcccttattaacact
aaggaatcacaagctattgcagatgaagttgctgataaagccattacccttgttaaagat
aaacaaaaagatattttgcctgttacccctgatcgctacaaacgcattttgattgttaat
gtggaagggcataaaggaggttttggggccatgattgccggtcagaaaaaacgagcttca
aatgtagttaaagacctactacaagcacggggacatgacgtaacagtttgggaatcaact
gaagaacgaattatgcagttacctgaaaatgagcgcgcagcggctatcgctaatgtttat
gctcaaaagcaaccaatttcaaatttaacagatcattatgatttaatccttaacttagtg
gatgtcaattctggcggaactgttcaaagaattgtatggccagcagctaaaggcacacca
gatcagccgttttatgtgcatgagattccaactattgtagtttctgtacaacatgctttt
gcccttgcggacatgccacaagtaggaacttatattaatgcttatgacggcaaagataat
acgatgaaatatctggttgaaaaattagctggcgaatcaactttcacaggtgtttctcct
gtggatgccttctgtggtctaattgatactcacttatggcgagagtattaa

DBGET integrated database retrieval system