KEGG   Streptococcus pasteurianus: SGPB_1406Help
Entry
SGPB_1406         CDS       T01524                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
stb  Streptococcus pasteurianus
Pathway
stb00010  Glycolysis / Gluconeogenesis
stb00051  Fructose and mannose metabolism
stb00562  Inositol phosphate metabolism
stb01100  Metabolic pathways
stb01110  Biosynthesis of secondary metabolites
stb01120  Microbial metabolism in diverse environments
stb01130  Biosynthesis of antibiotics
stb01200  Carbon metabolism
stb01230  Biosynthesis of amino acids
Module
stb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
stb_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:stb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGPB_1406 (tpiA)
   00051 Fructose and mannose metabolism
    SGPB_1406 (tpiA)
   00562 Inositol phosphate metabolism
    SGPB_1406 (tpiA)
Enzymes [BR:stb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SGPB_1406 (tpiA)
Exosome [BR:stb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SGPB_1406 (tpiA)
  Exosomal proteins of bladder cancer cells
   SGPB_1406 (tpiA)
  Exosomal proteins of melanoma cells
   SGPB_1406 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: BAK30444
UniProt: F5X2D5
Position
complement(1466855..1467613)
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFVEAVASKLPSSELVEAGIAAPALDLSTVLAAAKGSNL
KVAAENCYFENAGAFTGENSPQVLSEMGTDYVVIGHSERREYFHETDEDINKKAKAIFAN
GMLPIICCGETLETYEAGKAAEFVGGQVSAALAGLSEEQVSSLVIAYEPIWAIGTGKSAS
QDDAQKMCKVVRDTVAADFGQVVADKVRVQYGGSVKPENVAAYMACPDVDGALVGGASLQ
PESFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttatcgctggtaactggaaaatgaacaaaaatccagaagaagct
aaagcattcgttgaagcagtagcttctaaattgccttcatcagaacttgttgaagctggt
attgcagctcctgcacttgacctttcaacagttcttgctgcagctaaaggttcaaacctt
aaagttgctgctgaaaactgttactttgaaaacgctggtgcttttactggtgaaaacagt
cctcaagtattgtctgaaatgggaactgactacgttgtaatcggtcactcagaacgtcgt
gaatacttccacgaaactgacgaagatatcaacaaaaaagctaaagcaatctttgctaac
ggtatgcttccaatcatctgttgtggtgaaactcttgaaacttacgaagctggtaaagct
gctgaattcgtaggtggacaagtttcagctgctcttgctggattgtcagaagaacaagtt
tcttcacttgttatcgcgtacgaaccaatctgggctatcggtactggtaaatcagctagt
caagatgatgcacaaaaaatgtgtaaagttgttcgtgacacagttgcagcagacttcggt
caagtagtagctgataaagttcgcgttcaatacggtggttcagttaaacctgaaaatgtt
gcagcttatatggcttgcccagacgttgatggtgcccttgttggtggtgcatcacttcaa
ccagaaagcttccttgctcttcttgactttgtaaaataa

DBGET integrated database retrieval system