KEGG   Streptococcus pasteurianus: SGPB_1671
Entry
SGPB_1671         CDS       T01524                                 

Definition
(GenBank) Tn916 ORF15 signal peptide containing protein
Organism
stb  Streptococcus pasteurianus
SSDB
Motif
Pfam: TrbL YtxH
Other DBs
NCBI-ProteinID: BAK30695
UniProt: F5X336
Position
1731310..1733487
AA seq 725 aa
MKPSIVNRIKSNWTLKRLGKVAMTVAFTLVIAIFLLAMLGTVVQAAGLVDDTVNVANEYS
RYPLENYQLDFYVDNSWGWLPWNWSDGIGKQVMYGLYAITNFIWTISLYVSNATGYLVQE
AYSLDFISATADSIGKNMQTLAGVSANGFSTEGFYVGFLLLLILVLGVYVAYTGLIKRET
TKAIHAIMNFVLVFILSASFIAYAPDYIKKINDFSSDISNASLSLGTKIVMPHSDSQGKD
SVDLIRDSLFSIQVQQPWLLLQYNSSDIESIGIDRVESLLSTSPDSNNGEDREKIVAEEI
EDRSNTNLTITKTINRLGTVFFLFVFNIGISIFVFLLTGIMIFSQVLFIIYAMFLPVSFI
LSMIPSFDGMSKRAITKLFNTILTRAGITLIITTAFSISTMLYTLSAGYPFFLIAFLQIV
TFAGIYFKLGDLMSMFSLQSNDSQSVGSRVMRKPRMLMHAHMHRLQRKLGRSMTTLGAGS
AIVTGKKGQSGSGSSARTQADHSRPDGKEKSTLGKRIGQTIGTVADTKDRMVDTASGLKE
QVKDLPTNARYAVYQGKSKVKENVRDLTSSISQTKADRASGRKEQQEQRRKTIAKRRSEM
EQVKQKKQPASSVHERPTTRQEQYHDEQTSKQSNIQTSYKESQQAKQERPAVKSDFSSPK
VERQGNTVQEKTVQKPATSTTTADRTSQRPITKERPSTVQRVPLQNTRSRPPIKTATIKK
VGKKP
NT seq 2178 nt   +upstreamnt  +downstreamnt
gtgaaaccatcaatagtaaacagaataaaatcaaactggacgctgaaacgtctaggtaaa
gtggcaatgacagtggctttcacacttgtgattgccatttttcttttagccatgctggga
acggtggttcaagctgcgggcttggtagatgatacggtcaatgtggcaaatgaatacagc
cgatacccacttgaaaactatcaactggatttttatgtggataatagctggggctggctt
ccgtggaactggtcggacgggattggaaaacaggtcatgtatggactatatgccattacc
aattttatttggacaatcagtttgtatgtttccaatgcgacaggttacttagtacaggaa
gcctattccttagacttcatttccgctacagcagattccattggtaagaatatgcagacc
ttagctggtgtgagtgcaaacggattttcaacagagggtttctatgttggattcctctta
ctcttgattttggttcttggggtttatgttgcctatacgggactgataaagagagaaacc
acaaaggcaattcatgccattatgaattttgtgctggtgtttatcctatcggcttccttt
attgcctacgctcccgactacattaaaaaaatcaatgacttttcatcagacatcagtaat
gccagtttatcacttggcacgaagattgtcatgccccattccgatagtcaaggcaaggac
agcgtggacttaatcagagatagcctgttttccatacaggttcagcaaccgtggctactg
cttcaatacaacagttcagacattgaaagtatcggtattgaccgtgtggaaagcctgctc
tccaccagcccagattccaacaatggcgaagacagagaaaaaattgttgcggaagaaatt
gaagacagaagcaataccaatctaaccattacaaagaccattaaccgtttaggtacagtc
ttcttcctatttgtcttcaatattgggatttccatatttgtattcctattaacaggaatc
atgattttctcgcaggtactttttatcatctatgctatgtttctgcctgtgagctttatt
ttaagcatgattccatcatttgatggtatgtcaaaacgagccataacaaagctctttaat
accattttgacacgagctggaatcacattgattattacgacagcatttagtatttcaacc
atgctctataccttatcggctggttatccgttctttttgattgcttttctacagattgtg
acctttgcaggaatctacttcaagctgggcgatttaatgagtatgttttctctacagagt
aacgattctcaaagtgtgggaagtcgtgtgatgagaaaacctcgtatgcttatgcacgct
cacatgcaccgtctacagcggaaacttggacgttccatgactactctaggggctgggtct
gccattgttacaggtaaaaaaggacagtcgggttcggggagttctgcaaggacacaagca
gatcactcccgaccagacggaaaggaaaaatcaacacttggaaaacgtatcggtcaaacc
atcggtacagtagctgataccaaagacagaatggtagacactgctagtggtttgaaagaa
caggttaaagatttgccgaccaatgcaagatatgcagtatatcaaggaaaatccaaagta
aaagagaatgtccgtgatttaaccagtagtatttctcaaaccaaagcggacagagccagt
ggacgcaaggaacagcaggaacaaaggcgaaaaaccattgcgaagcgtcgctctgaaatg
gaacaggtcaaacagaaaaaacagcctgcttcttctgttcatgaaagaccgactacaaga
caagaacaatatcatgatgaacagacctcaaaacagtctaatattcagacttcatataag
gaatctcaacaagccaaacaagagcgtccagcagttaagtccgatttttcaagtccaaaa
gtggaacgccaaggcaataccgttcaagaaaaaaccgttcaaaagccagcaacttcaacc
actacagcagatagaacttcacaacgtccaatcacaaaagaacgtccgtctactgttcaa
agagtaccactacaaaatacaagaagtagaccaccaatcaaaaccgccaccattaagaaa
gtcggtaagaaaccatga

DBGET integrated database retrieval system