KEGG   Streptococcus thermophilus CNRZ1066: str0488Help
Entry
str0488           CDS       T00212                                 

Gene name
tpi
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
stc  Streptococcus thermophilus CNRZ1066
Pathway
stc00010  Glycolysis / Gluconeogenesis
stc00051  Fructose and mannose metabolism
stc00562  Inositol phosphate metabolism
stc01100  Metabolic pathways
stc01110  Biosynthesis of secondary metabolites
stc01120  Microbial metabolism in diverse environments
stc01130  Biosynthesis of antibiotics
stc01200  Carbon metabolism
stc01230  Biosynthesis of amino acids
Module
stc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
stc_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:stc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    str0488 (tpi)
   00051 Fructose and mannose metabolism
    str0488 (tpi)
   00562 Inositol phosphate metabolism
    str0488 (tpi)
Enzymes [BR:stc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     str0488 (tpi)
Exosome [BR:stc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   str0488 (tpi)
  Exosomal proteins of bladder cancer cells
   str0488 (tpi)
  Exosomal proteins of melanoma cells
   str0488 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AAV62087
UniProt: Q5M100
Position
463823..464581
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFVEAVASKLPSADLVEAGIAVPAVDLTTVIAAAKGSNL
KVAAQNTYFENSGAFTGETSPQVLKEIGTDYVVIGHSERRDYFHETDEDINKKAKAIFAN
GMIPIICCGESLETYEAGKAAEFVGAQVSAALAGLTPEQVASSVIAYEPIWAIGTGKSAS
QDDAQKMCKVVRDVVAADFGQEVADKVRVLYGGSVKPENVAEYMACPDVDGALVGGASLE
PESFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttatcgctggtaactggaaaatgaacaaaaacccagaagaagca
aaagcatttgttgaagctgtagcgtcaaaattgccttcagctgaccttgttgaagctggt
attgcggttcctgcagttgatttgacaactgttattgctgctgctaaaggttcaaacctt
aaagttgctgcacaaaacacttactttgaaaattcaggtgctttcactggtgaaactagc
ccacaagttttgaaagaaatcggtactgactatgttgttatcggtcactcagaacgtcgt
gactacttccacgaaaccgatgaagacatcaacaaaaaagctaaagcaatctttgctaac
ggtatgattccaatcatctgttgtggtgaatcccttgaaacttacgaagctggtaaagca
gcagaattcgtaggtgctcaagtttcagctgctttagctggattgactcctgagcaagta
gcttcatcagttattgcgtacgaaccaatctgggctatcggtaccgggaaatcagcttca
caagacgatgcacaaaaaatgtgtaaagttgtgcgtgatgttgtggcagctgacttcggt
caagaagtcgctgacaaagtacgtgttctatacggtggttcagttaaacctgaaaacgtt
gctgaatacatggcttgtccagatgttgacggagctcttgtaggtggtgcatcacttgaa
cctgaaagtttcttggcattgcttgacttcgttaaataa

DBGET integrated database retrieval system