KEGG   Streptococcus thermophilus CNRZ1066: str0728Help
Entry
str0728           CDS       T00212                                 

Gene name
glcK
Definition
(GenBank) glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
stc  Streptococcus thermophilus CNRZ1066
Pathway
stc00010  Glycolysis / Gluconeogenesis
stc00052  Galactose metabolism
stc00500  Starch and sucrose metabolism
stc00520  Amino sugar and nucleotide sugar metabolism
stc00521  Streptomycin biosynthesis
stc01100  Metabolic pathways
stc01110  Biosynthesis of secondary metabolites
stc01120  Microbial metabolism in diverse environments
stc01130  Biosynthesis of antibiotics
stc01200  Carbon metabolism
Module
stc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
stc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:stc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    str0728 (glcK)
   00052 Galactose metabolism
    str0728 (glcK)
   00500 Starch and sucrose metabolism
    str0728 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    str0728 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    str0728 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    str0728 (glcK)
Enzymes [BR:stc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     str0728 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Pan_kinase
Motif
Other DBs
NCBI-ProteinID: AAV62321
Position
684551..685519
Genome map
AA seq 322 aa AA seqDB search
MSKKLLGIDLGGTTVKFGILTADGEVQEKWAIETNTFENGSHIVPDIVESLKHRLELYGL
TAEDFIGIGMGSPGAVDRENKTVTGAFNLNWAETQEVGSVIEKELGIPFAIDNDANVAAL
GERWVGAGANNRNVVFITLGTGVGGGVIADGNLIHGVAGAGGEIGHIIVEPDTGFECTCG
NNGCLETVASATGIVRVTHHLAEKYEGNSSIKAAVDNGEFVTSKDIIVAATEGDKFADSI
VDKVSKYLGLATANISNILNPDSVVIGGGVSAAGEFLRSRVEGYFTRYAFPQVRRTTKVK
LAELGNDAGIIGAASLAYSIDK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagaaactcttaggtattgaccttggtggaacaactgttaagtttggtattttg
actgcagatggtgaagttcaagaaaaatgggctattgaaacaaatacgtttgaaaatggt
agccacattgttcctgacattgtagaatctttgaaacaccgtttggaattgtatggactt
actgctgaagattttattggaattggtatgggatctccaggtgcagttgaccgagaaaat
aaaacagtaacgggtgcctttaacttgaactgggcagaaactcaagaagttggctctgtt
attgaaaaagaacttggtattccattcgctattgataatgatgctaatgtagctgcactg
ggtgaacgttgggttggtgctggtgctaacaatcggaatgttgtctttataacattgggt
acaggtgttggtggcggtgttatcgctgatggtaacttaattcatggtgttgccggtgct
ggtggggaaattggtcacattattgttgaacctgacacaggatttgagtgtacttgcgga
aacaatgggtgtctggaaactgtagcttcagcaacaggtattgtacgtgtaacacatcat
ttggcagaaaaatacgaaggaaactcttctattaaagctgctgtagacaatggtgagttt
gtgacaagtaaagatattatcgtagctgctactgaaggtgataagtttgctgacagcatt
gttgataaagtctctaaatacctcggacttgcaacagcaaacatctcaaacattcttaac
ccagattctgtcgttatcggtggtggtgtttctgccgcaggagaattcttgcgtagtcgt
gttgaaggatactttacacgttatgcattcccacaagttcgccgtacaacaaaagtgaaa
ttagcggagcttggaaatgatgcaggaatcattggagctgctagtcttgcttatagtatt
gacaaataa

DBGET integrated database retrieval system