KEGG   Streptococcus thermophilus CNRZ1066: str0770
Entry
str0770           CDS       T00212                                 

Gene name
pacL1
Definition
(GenBank) calcium transporter P-type ATPase
  KO
K01537  P-type Ca2+ transporter type 2C [EC:7.2.2.10]
Organism
stc  Streptococcus thermophilus CNRZ1066
Brite
KEGG Orthology (KO) [BR:stc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    str0770 (pacL1)
Enzymes [BR:stc01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     str0770 (pacL1)
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase Hydrolase Cation_ATPase_N Hydrolase_3 Cation_ATPase NYN_YacP
Other DBs
NCBI-ProteinID: AAV62363
Position
complement(723717..726353)
AA seq 878 aa
MKKFKGLTSAEVQASKNAHGDNRLSSKEANSLLSIFIEAFQDQWILILLAALGLKIIFNF
VAMIFPAIGEANWYEAISLIFAILMSTGFSAVSQYRNEQKFNILQEEASKTNAKVYRDGK
LKEILVDDVVKGDQILLQSGDKIPVDGIILEGKLKVNQAVLNGESEDATKLPLGDREEPD
SSDLFTEFKVFRGTVVTSDEAVIEATQIGDNTVLGSINTSLQEDSKNSPSKEKLNKLARN
IGVLGYSAGAAYSVINLVLGFIALNKANNLNGGSIFLLIIETILFAVTIIIMAVPEGLPM
MLALVSSMNSGRLLAQNILVRHPDTIETAGYMNILFSDKTGTITEGKLSVVDFFLGDGTL
YAATGETDAPDFDTMSDSLKAEIINGIGLNNDAMVADGNAVGSNATDRALLDFLIGRSQL
DFDTNTITEKQQFNSATKFASVTTNDGKTYIKGAPEFILNDCYYYLDKDGHKQNFTDDIK
ARFQELSLEQANRSMRLLAILNTDGNNKVLIGIVCIRDNVRSSIKQTVETMNRAGVQVVM
VTGDRKETAVAIAKEAGIVTGENDLVLTHDELSALSDQELKQQLPHLKVVSRALPMDKKR
LIEVAQELDMVAGMTGDGVNDSPALKSADVGFSMGDGTEVAREASDIVILNNSLTSIEKA
VLYGRTMSKSVSKFIIFQLTVNVTTIAMSLLSPLLGLKEPFTIIQILWVNLIMDTLAALA
FGEEPALDRYMNEKPVAKKANILTGYMKSAIGVASAFITLVCLAILKNVGGIQDFITNGT
GNFEMVTTFTFTVFIYAVIFNSFNTRSNGFNIFEHIGKNKKFLIVMISIAVVQTLIIQFG
GKVFSTVPMDIQHYIITLLIAVLIIPADFIRKALTKNK
NT seq 2637 nt   +upstreamnt  +downstreamnt
atgaaaaaatttaaaggcttgacttctgcagaagttcaagcaagtaaaaacgctcatggc
gataataggctctctagtaaagaggctaactcgctgctttcaatttttattgaagccttc
caggatcaatggattctcatcctcttggctgccttaggattaaaaatcatcttcaacttt
gttgcaatgatttttcctgctattggggaggctaattggtatgaggctatctcactaatt
tttgccattttgatgtctacagggttctcagcagtctctcaataccgtaatgagcaaaaa
ttcaatattctccaagaagaggcttcaaaaactaatgctaaggtttatcgagatggtaaa
cttaaagagattctcgtggatgatgttgtaaaaggggatcaaattctccttcaatcaggg
gacaagattccagttgacggtatcatcttggaaggtaaattaaaagtaaaccaagctgtc
ttaaatggtgaaagcgaggatgccacaaaacttcctcttggtgaccgagaagagccagat
tcttcagacctctttacagagtttaaggtcttccgtggtacagtcgtaacttcagatgaa
gctgtgattgaagctacacaaattggtgataacaccgttttaggaagtatcaatacgtct
cttcaagaagatagtaaaaattcaccatctaaagaaaaacttaacaagcttgcaagaaac
atcggggtcctcggttatagtgcaggtgctgcctattcagtaatcaaccttgtattaggc
tttattgccctaaataaagctaacaacctcaatggtggctcgattttccttcttatcatt
gaaacaattctctttgcggttacaatcatcatcatggctgtcccagaaggacttccaatg
atgttagcactcgtttcctcaatgaactcaggtcgacttttagctcaaaatatcctagtc
cgccatcctgatactattgaaactgctggatacatgaatattctcttcagtgataagact
ggtacaatcacagaaggtaaactatctgtagttgacttcttccttggggatggaacactt
tatgcagctactggtgaaaccgatgctccagattttgatacgatgtcagatagtcttaaa
gctgaaataattaatggtatcggtcttaataacgatgccatggttgctgatggcaatgct
gttggtagtaatgctactgaccgtgcacttcttgacttcttgattggacgttctcaactt
gatttcgatactaatacaattactgagaagcaacaattcaactcagcaacaaaattcgca
agtgtaacgactaacgatggaaaaacctacatcaaaggtgctccagaatttatcctaaat
gactgctactactatcttgataaagatggtcataaacaaaactttacagatgatattaaa
gctcgttttcaagagttatcattggaacaagctaaccgttcaatgcgtttgcttgccatc
ctcaatacagatggtaataataaagtcttgattggtatcgtatgtatccgtgataacgtt
cgctcttcaattaaacaaaccgttgaaacaatgaaccgtgcgggtgttcaagtagttatg
gtgactggtgaccgtaaagaaaccgctgttgctatcgctaaagaagcaggtatcgtcact
ggagaaaatgaccttgtccttactcacgatgaactttctgccctctcagatcaagaactt
aaacaacaattgcctcacttaaaagtggtaagtcgtgcccttccaatggataaaaaacgt
cttattgaggtagctcaagaactcgatatggtagctggtatgacgggtgatggggtcaat
gactcaccagcccttaaatcagctgatgttggtttctcaatgggtgatggtactgaagtc
gcacgtgaagcctcagatatcgttatcttaaacaactcattgacttctattgagaaagcc
gttctctatggacgcaccatgagtaagtcagtaagtaaatttatcatcttccaattaact
gttaacgtaacaactattgccatgtcacttctctcaccacttttgggtctcaaagagcca
tttacaatcatccaaattctctgggttaaccttatcatggacacacttgctgcccttgcc
tttggtgaagagcctgcgctagatcgttatatgaacgaaaaaccagtagctaagaaagca
aatattcttactggttatatgaaatccgctatcggagttgcaagtgccttcattactctt
gtatgtttagccattcttaaaaatgttggtggtatccaagactttatcacaaatggaact
ggtaactttgaaatggtaacaacctttacatttacagtatttatctatgctgttattttc
aactcatttaatacacgtagtaatggcttcaatatttttgaacatatcggtaaaaacaag
aaattcttaatcgttatgatttctattgctgttgttcaaacccttattattcaatttggt
ggaaaagtatttagtactgttccgatggatattcaacactatatcattactcttcttatt
gctgtattgattataccagcagatttcattcgaaaagctctaactaaaaacaaataa

DBGET integrated database retrieval system