KEGG   Streptococcus thermophilus CNRZ1066: str1590Help
Entry
str1590           CDS       T00212                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
stc  Streptococcus thermophilus CNRZ1066
Pathway
stc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
stc01100  Metabolic pathways
stc01110  Biosynthesis of secondary metabolites
stc01130  Biosynthesis of antibiotics
stc01230  Biosynthesis of amino acids
Module
stc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:stc00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    str1590 (trpC)
Enzymes [BR:stc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     str1590 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS Tox-MPTase4
Motif
Other DBs
NCBI-ProteinID: AAV63120
UniProt: Q5LYI5
Position
complement(1415204..1415971)
Genome map
AA seq 255 aa AA seqDB search
MSKAFLPTILEQKEKEVAQLVMEDLQPLRQTYRLYDFLKSNQNKLQIISEVKKASPSMGD
INLDVDIVAQAKTYEENGAAMISVLTDEVFFKGDISYLKEISTQVAIPTLAKDFIIDEKQ
IVRSRNAGATVILLIVAALPEARLKELYDFATSLGLEVLVETHNLPELEVAHRIGAEIIG
VNNRNLMTFETDINTSLELSTHFKDKPVYISESAIFTGQDAALVAPYFNGILVGTALMTA
DNVAKKVKELQIDKG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagcttttcttccaacaatcctagaacaaaaagaaaaagaagtggcccagttg
gtcatggaagacttacagcccttgcgtcagacctatcgcctttatgattttctcaagtca
aatcaaaacaagttgcaaattatttctgaagtgaagaaagccagtccaagtatgggtgat
attaacctagatgtggatattgtagctcaggccaagacctatgaggaaaatggggcagcc
atgatttcagttttgactgacgaagtcttcttcaaaggtgatatttcctatttgaaagaa
atttcgacacaggtagcgattccaaccttggctaaggacttcattattgatgagaaacag
attgtgcgtagccgtaatgcgggtgcgacagtcattctcttgattgtagcggccttgcca
gaagctcgtctcaaggagctctatgattttgcgactagccttggcttggaagtcttggtt
gaaacgcataatctgccagaattggaagtggctcaccgtattggtgctgaaattatcgga
gtaaacaaccgtaatttgatgacatttgagacagatattaataccagtcttgagttatcg
acgcatttcaaggataaacctgtttatatttctgagtcggctatttttacaggtcaggat
gctgccctagttgccccatattttaatgggattctggtaggaactgcccttatgacggct
gacaatgtggctaaaaaggtcaaggagttgcaaattgacaaaggttaa

DBGET integrated database retrieval system