KEGG   Streptococcus thermophilus CNRZ1066: str1884Help
Entry
str1884           CDS       T00212                                 

Definition
(GenBank) alcohol-acetaldehyde dehydrogenase, truncated
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
stc  Streptococcus thermophilus CNRZ1066
Pathway
stc00010  Glycolysis / Gluconeogenesis
stc00620  Pyruvate metabolism
stc00625  Chloroalkane and chloroalkene degradation
stc00626  Naphthalene degradation
stc00650  Butanoate metabolism
stc01100  Metabolic pathways
stc01110  Biosynthesis of secondary metabolites
stc01120  Microbial metabolism in diverse environments
stc01130  Biosynthesis of antibiotics
stc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:stc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    str1884
   00620 Pyruvate metabolism
    str1884
   00650 Butanoate metabolism
    str1884
  09103 Lipid metabolism
   00071 Fatty acid degradation
    str1884
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    str1884
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    str1884
   00626 Naphthalene degradation
    str1884
Enzymes [BR:stc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     str1884
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     str1884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Sun2_CC2
Motif
Other DBs
NCBI-ProteinID: AAV63397
Position
complement(1685360..1685755)
Genome map
AA seq 131 aa AA seqDB search
MTKQTKYVQTVIDELATKGVEALDAMANFTQEQVDHIVHQAAIAALDKHMYLAKLAVDET
GRGIYEDKAIKNMYASEYIWNSIKYDKPVGVIAEDKEQGLVSIAEPVGVICGVTPTTNPT
SITIFKALIAL
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgactaaacaaactaaatatgttcaaacagtaatagatgaattggcaacaaaaggtgtt
gaagccctcgatgccatggctaactttacgcaggagcaagtggaccacattgttcaccaa
gctgcgattgctgctctagataaacatatgtatttggcaaaattggctgttgatgaaaca
ggccgtggtatttatgaagataaagccatcaaaaacatgtatgcttctgaatacatttgg
aatagtattaaatatgacaagccagtaggcgttatcgctgaagataaagaacaaggtttg
gtttctatcgctgagccagtaggcgttatctgtggggtgacaccaacaactaacccaacc
tcaataacgattttcaaagcccttatcgctctttag

DBGET integrated database retrieval system