KEGG   Streptococcus pseudopneumoniae: SPPN_01460Help
Entry
SPPN_01460        CDS       T01590                                 

Definition
(GenBank) Tn916 ORF14 extracellular hydrolase/peptidase
Organism
std  Streptococcus pseudopneumoniae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lysozyme_like NLPC_P60 SLT DUF1175 CHAP
Motif
Other DBs
NCBI-ProteinID: AEL09736
UniProt: G0IBG1
Position
234168..235169
Genome map
AA seq 333 aa AA seqDB search
MKLKTLVIGGSGLFLMVFSLLLFVAILFSDEQDSGISNIHYGGVNVSAEVLAHKPMVEKY
AKEYGVEEYVNILLAIIQVESGGTAEDVMQSSESLGLPPNSLSTEESIKQGVKYFSELLA
SSERLSVDLESVIQSYNYGGGFLGYVANRGNKYTFELAQSFSKEYSGGEKVSYPNPIAIP
INGGWRYNYGNMFYVQLVTQYLVTTEFDDDTVQAIMDEALKYEGWRYVYGGASPTTSFDC
SGLTQWTYGKAGINLPRTAQQQYDVTQHIPLSEAQAGDLVFFHSTYNAGSYITHVGIYLG
NNRMFHAGDPIGYADLTSPYWQQHLVGAGRIKQ
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgaaaactttagtgattggtggttctggattattcttgatggtcttctcactg
cttctgtttgttgccattttattttcagatgaacaggacagcggaatttccaatattcat
tatggaggtgtgaatgtttccgcagaagtgctggctcataagcctatggtagaaaaatat
gccaaagaatatggcgttgaagaatatgtcaacatacttcttgcgattatacaggtggaa
tcgggcggtactgcggaagatgttatgcagtcctcggaatccctcggtcttccacctaat
tcattgagtacagaagaatccattaagcaaggtgtgaagtatttcagtgaattattagcc
agtagcgaaaggctcagtgtagatttagaatcggttatccagtcctacaattatggtggt
ggtttcttagggtatgtggctaatcgtggaaataaatatacctttgaactggctcaaagt
ttctcaaaagagtattcaggtggcgaaaaagtgtcttaccccaatcccatagccatacct
atcaatgggggctggcgatacaactatggcaatatgttttatgtgcaactggtaacgcag
tatcttgtcacaacagagtttgatgatgatacggtacaagccatcatggacgaagcactg
aaatatgagggctggcgatacgtttacggtggagcttccccgactacttcttttgattgt
agcggactgacacaatggacgtatggaaaagctggaattaacttaccacgaaccgcacaa
cagcaatatgatgtgacccagcatatcccactatcggaagcacaagctggcgatttggtt
ttctttcattctacctataacgctggctcttatattactcatgttgggatataccttggc
aataaccgtatgtttcatgcaggcgacccaatcggttatgccgacttaacaagcccctac
tggcaacagcatttagtgggagcaggacgaatcaaacaatga

DBGET integrated database retrieval system