KEGG   Streptococcus pseudopneumoniae: SPPN_02165Help
Entry
SPPN_02165        CDS       T01590                                 

Definition
(GenBank) ethanol-active dehydrogenase/acetaldehyde-active reductase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
std  Streptococcus pseudopneumoniae
Pathway
std00010  Glycolysis / Gluconeogenesis
std00625  Chloroalkane and chloroalkene degradation
std00626  Naphthalene degradation
std01100  Metabolic pathways
std01110  Biosynthesis of secondary metabolites
std01120  Microbial metabolism in diverse environments
std01130  Biosynthesis of antibiotics
std01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:std00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPPN_02165
  Lipid metabolism
   00071 Fatty acid degradation
    SPPN_02165
  Amino acid metabolism
   00350 Tyrosine metabolism
    SPPN_02165
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SPPN_02165
   00626 Naphthalene degradation
    SPPN_02165
Enzymes [BR:std01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SPPN_02165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Methyltransf_25 Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: AEL09875
UniProt: G0ICB1
Position
complement(367952..368971)
Genome map
AA seq 339 aa AA seqDB search
MKAVVVNPESTGVAVEEKVLRPLETGEALVEIEYCGVCHTDLHVAHGDFGQVPGRVLGHE
GVGIVKEIAPDVKSLKVGDRVSVAWFFEGCGTCEYCTTGRETLCRTVKNAGYSVDGGMAE
QCIVTADYAVKVPDGLDSAQAPSITCAGVTTYKAIKEAKVEPGQWVVLYGAGGLGNLAVQ
YAKKVFNAHVIAVDINNDKLALAKEVGADIVINGLEVEDVAGLIKEKTDGGAHSAVVTAV
SKVAFNQAVDSVRAGGHVVAVGLPSEMMELSIVKTVLDGIQVIGSRVGTRKDLEEAFQFG
AEGLVVPVVQKRPVEDAVAIFDEMEKGQIQGRMVLDFTH
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgttgttgtaaatccagaaagcactggtgttgctgttgaagaaaaagtactc
cgtccacttgaaactggggaagcacttgtagaaattgaatactgtggtgtttgccacacc
gaccttcacgttgctcatggtgacttcggtcaggtaccaggacgtgtccttggccacgaa
ggtgttggtatcgttaaagaaattgctccagatgtgaaaagccttaaagtcggtgaccgc
gtcagcgttgcttggttctttgaaggatgtggcacttgcgaatactgtacaactggtcgc
gaaaccctttgccgtacagtgaaaaatgctggctactcagtagacggtggtatggctgaa
caatgtatcgtaactgctgactatgctgtcaaagttcctgacggacttgattcagcccaa
gctccttctatcacatgtgctggagtaacaacctataaagctatcaaagaagcaaaagtt
gaaccaggccaatgggttgttctttacggtgctggtggacttggtaacctcgctgttcaa
tacgctaaaaaagtattcaatgctcatgttatcgcagtcgatatcaacaatgacaaactt
gcccttgcaaaagaagtaggcgctgacattgtgattaacggcctcgaagttgaagatgta
gctggactcatcaaggaaaaaactgatggtggagctcattcagctgtcgtaactgctgta
tctaaagttgccttcaaccaggctgttgactcagttcgtgctggtggtcacgtcgtcgct
gtcggccttccttctgaaatgatggaactaagtatcgtaaaaaccgttctagatggaatc
caagtcatcggttctcgcgttggaactcgtaaagacttggaagaagccttccaattcggt
gcagaaggtttggtagttccagttgttcaaaaacgtccagtagaagatgctgttgccatt
ttcgacgaaatggaaaaaggtcaaatccaaggacgtatggtactcgacttcacccactaa

DBGET integrated database retrieval system