KEGG   Streptococcus pseudopneumoniae: SPPN_04535Help
Entry
SPPN_04535        CDS       T01590                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
std  Streptococcus pseudopneumoniae
Pathway
std00010  Glycolysis / Gluconeogenesis
std00030  Pentose phosphate pathway
std00051  Fructose and mannose metabolism
std00052  Galactose metabolism
std00680  Methane metabolism
std01100  Metabolic pathways
std01110  Biosynthesis of secondary metabolites
std01120  Microbial metabolism in diverse environments
std01130  Biosynthesis of antibiotics
std01200  Carbon metabolism
std01230  Biosynthesis of amino acids
std03018  RNA degradation
Module
std_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:std00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPPN_04535
   00030 Pentose phosphate pathway
    SPPN_04535
   00051 Fructose and mannose metabolism
    SPPN_04535
   00052 Galactose metabolism
    SPPN_04535
  Energy metabolism
   00680 Methane metabolism
    SPPN_04535
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SPPN_04535
Enzymes [BR:std01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SPPN_04535
Protein phosphatases and associated proteins [BR:std01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SPPN_04535
Messenger RNA biogenesis [BR:std03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SPPN_04535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: AEL10345
UniProt: G0I8L2
Position
879030..880037
Genome map
AA seq 335 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVFGIYDGYAGMVAGEIHPLDAASVGDI
ISRGGTFLHSARYPEFAQLEGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAI
GLPGTIDNDIVGTDFTIGFDTAVTTAMDAIDKIRDTSSSHRRTFVIEVMGRNAGDIALWA
GIATGADEIIIPEEGFKIEDIVESIKCGYECGKKHNIIVLAEGVMSAAEFGQKLKEAGDT
SDLRVTELGHIQRGGSPTARDRVLASRMGAHAVKLLKEGIGGVAVGIRNEKMVENPILGT
AEEGALFSLTAEGKIVVNNPHKADIELSSLNKSLS
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttgactagtggtggagacgcccctggtatgaacgctgctatc
cgtgcagttgttcgtcaagcaatttcagaaggaatggaagtgtttggtatctatgacgga
tatgctggtatggttgccggtgaaattcatcccctagatgcagcttcagtaggagacatc
atttctcgtggtggtactttccttcactcagctcgttacccagagttcgctcaacttgaa
gggcaactaaaagggattgagcaattgaaaaaacacggcattgaaggtgtagttgttatc
ggtggagacggttcttaccacggcgctatgcgtttgactgagcatggtttccctgctatc
ggtcttccaggtacaatcgataacgatatcgttggtactgactttacaatcggttttgac
acagcggttacaactgctatggatgctattgataagattcgtgatacatcatcaagtcac
cgtcgtacttttgttattgaagttatgggacgtaacgctggtgatatcgctctttgggct
ggtattgcaactggtgcagatgaaatcatcattcctgaggaaggattcaagattgaagac
atcgtagaaagcattaaatgtggttatgagtgtggtaaaaaacacaatatcatcgtctta
gctgaaggtgtgatgtcagcagctgaatttggtcaaaaacttaaagaagctggagataca
agcgaccttcgtgtgacagaacttggacatattcaacgtggtggttctccaactgcgcgt
gaccgtgtattggcgtcacgtatgggtgcccatgctgttaaacttcttaaagaaggtatt
ggtggtgttgcggttggtatccgtaacgagaaaatggttgaaaacccaattcttggaacg
gcagaagaaggagcattgtttagccttactgcagaaggtaagattgtagttaacaaccca
cacaaagccgatattgagctatctagcttgaataagagcttgtcataa

DBGET integrated database retrieval system