KEGG   Streptococcus pseudopneumoniae: SPPN_05625Help
Entry
SPPN_05625        CDS       T01590                                 

Definition
(GenBank) hypothetical protein
  KO
K01390  IgA-specific metalloendopeptidase [EC:3.4.24.13]
Organism
std  Streptococcus pseudopneumoniae
Brite
KEGG Orthology (KO) [BR:std00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:std01002]
    SPPN_05625
Enzymes [BR:std01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.13  IgA-specific metalloendopeptidase
     SPPN_05625
Peptidases [BR:std01002]
 Metallo Peptidases
  Family M26
   SPPN_05625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M26_C Peptidase_M26_N YSIRK_signal Gram_pos_anchor Glug
Motif
Other DBs
NCBI-ProteinID: AEL10561
UniProt: G0I9I4
Position
1063904..1070539
Genome map
AA seq 2211 aa AA seqDB search
MEKYFGEKQERFSFRKLSVGLVSATISSLFFMSVLASSSVAAQETKGVHYKYVTESELSS
EEKKQLVYDIPTYVENDDETYYLVYKLNSQNQLAELPNTGSKNEMQALVAGASLAALGIL
VFAVSKKKIKNKTVLHLVLVAGIGNGILVSAHALENNLLLNYNTDYELTSGEKLPLPKDI
SGYTYIGYIKEGKTTSDSKVSNQEKSVATPIDQQKVDYTIAPNFIENPSKIQVINGQYEA
VPEFRDGQVGTVATESAETKADTLSSDMNSEVESHSTPPTVDSSQNGENLGKQKEDATPV
EKPKEVEETNKPEKDESKDETSTKPENSGNAITEENGQTVPTESNQGDTNKVGESNKPEN
NDSKNETSEKTVEEVPVNPTEGSTEGTSNQGTENPVQSAEESTTNSEKVSPDTSKENTGE
VSSNPSDSTTSVEETNKPEKDESKDETSTKPENSGNAITEENGQTVPTESNQGDTNKVGE
SNKPENNDSKNETSEKTVEEVPVNPTEGSTEGTSNQGTENPVQSAEESTTNSGEDATPKS
GEKSGETKEESTDASEVPSATPVEKPKETDKVKEEGSLESNVSKMETPNTEDASEGNTSS
TMSSPQTDEESKINAPKDELPKTELEESEHPNSSNVATESTETKADTLSSDMNSEVESHS
TPPTVDSSQNGENLGKQGEDATPKPGENSGETKEESTDASEVHSATPVEKPKEQEPEKTV
EEVPVNPTEVTTEGTSNQGVENPVQSAEETTTNSENVSPDTSKENTGEMSSIPSDSTTSV
EETNKPEKDESKDETSEKTVEEVPVNPTEGSTEGTSNQEAENPVQPAEETTTNSENVSPD
TSKENTGEMSSIPSDSTTSVEETNKPENSAHPITESGQTEPEQSNGNSTEDVSSESNTAN
SNGNEEIKQENEVEPDKKVEVQEKTIELRSVSDVELYSYEDNQSKQHTSLDKVPDNKSAY
FIKVKSAKFKDVLLPVSNIEDTTKDGKPVYKITARLEHLKQSVDNQYQDNFTYYLPKLVQ
NDGPIYTSFKKLITDMNSRPSGTFTLGATMNAREFELNENQESYVTNNFTGTLIGSHQGK
HYAIYNLKKPLFNTLNRATVKDLTLKDVNISGKNHVASVAKEATNSSTLDNVHANGIIAG
ELGIGGLVQKVDNSTVRNSSFTGRITNTFVTKSQYAIGGLVGQLTGSNSVVDHSISTVTI
SSNGEHSNQTIGGIAGIVENNATVKNSYAEGEINNAKPFARVGGVAGSLWTNGSSTEDNS
GILQNVLSDMNITNGNAISGYHFNGMKKTAVYSNKDNKVVNVQAVGDEVMSVDSTVERGT
EIEKEAVQAKKDQITTKKTITVEDFTNSAKQDVDYTKATHYQAAREVAYKNIEKLLPFYN
RDTIVKYGNQLSADNNLFKKELLSVVAMKNEEVVSDITSDKHSINHLLLHYKDGTSEKVN
VTYHSDFANLAEYTIGTTGLVYTPNAFLKDYSSIIDRVKNDLNTVQYNPSALKNLLGISD
NVKLTELYLDEQFAKTKEHLTETLKKLLSADAAVTGNNSAIDNYMVDKIKRNKEALMLGL
TYLERWYDFKFDKASAKDLLMFHMDFFGKGNTSPLDTIIELGKSGYNNLLAKNNVVTYNA
LLTNNYGTKDLFSALEGYRKAFAPTQTNNDWFKSQTKAYIVEEKSNIPEVRANQEKAGSK
YSIGVYDRITSDSWKYRNMVLPLLTLPEKSVFVISTISSLGFGAYDRYRNSDYKAGDKLN
KFVEKSAHETAERQRDHYDYWYRILDEKGREKLYRNILLYDAYKFGNDNTEGKAKKVADF
DDPNPAMKHFFGPVGNNVGHNQHGAYATGDAVYYMGYRMLDKDGAITYTHEMTHDSDQDI
YLGGYGRRSGLGPEFFAKGLLQAPDHPNDATITINSILKHSKSDSTEGQRLQVLDPTTRF
KDATDLQNYVHNMFDVVYMLEYLEGKSITENLTNYQKMEALRKIENKYVEDREDGNKVYA
TNVVKDLTVEDAKKLTSFESLIDNNILSAREYKSKEYERNGYFTIKLFAPIYAALSSDIG
TPGDLMGRRIAYELLAAKGFKDGMVPYISNQYEEEAKQNGKKITIYGKERGLVTDDLVLK
KVFNGQYKTWTEFKKAMYKERQDKFGQLNTVSFKDPSIPWYIRETKTINSVTELQKLMDE
AVRKDAEDNRYSWYNYNPEYDSAVHKLKRAIFKAYLDQTDDFRSSIFENKK
NT seq 6636 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagtattttggtgaaaaacaagaacgtttttcatttagaaaattatcagtagga
cttgtatctgcaacgatttcgagtttattttttatgtctgtattagctagttcatctgtg
gctgctcaagagactaaaggtgttcactacaaatatgtgacagagtcagagctatcatca
gaagaaaagaagcagcttgtatatgatattccgacatacgtggagaatgatgatgagact
tattatcttgtttataagttaaattctcaaaatcaactggcggaattaccaaatactgga
agcaagaatgagatgcaagccttagttgctggtgctagtttagcagctctggggatttta
gtttttgctgtttccaagaaaaaaattaagaataaaacggtattacatttagtattggtt
gcagggataggaaacggtatcctagtatcagcccatgctttagaaaataatcttttactg
aattacaatactgactatgagttgacctctggagaaaaattacctcttcctaaagatatt
tcaggttacacttatattggatatatcaaagagggaaaaacgacttctgattctaaggta
agtaatcaagagaaatcagtagccactccaatagatcaacaaaaggtagattatacgatt
gcaccgaattttatagagaatccatcaaaaatacaagtgattaacggacagtatgaggct
gttccagaatttagggatggacaagttggaactgtagctacagagtccgctgaaactaaa
gctgatacattatctagtgatatgaactcagaagtggaaagtcactctacacctccaacc
gtagattcttctcagaacggagagaatcttggaaaacagaaagaagatgcaactccagtc
gagaagccaaaagaagtagaagaaacaaacaaacctgaaaaagatgagtcaaaagacgaa
acttcaacaaaacctgaaaattctggtaatgcaataacagaagagaatgggcaaacagta
ccaactgaatctaatcaaggtgatacaaataaagttggagagtcaaataaaccagaaaat
aatgactccaaaaatgaaacttcagaaaaaactgtagaagaagttccagtaaatccaaca
gaaggctctacagaaggaacctcaaatcaaggaacagaaaatccagttcaatctgcagaa
gaatcaacaacgaattcagagaaagtatcaccagatacatctaaagaaaatactggggaa
gtgtccagtaatcctagtgattcgacaacctcagttgaagaaacaaacaaacctgaaaaa
gatgagtcaaaagacgaaacttcaacaaaacctgaaaattctggtaatgcaataacagaa
gagaatgggcaaacagtaccaactgaatctaatcaaggtgatacaaataaagttggagag
tcaaataaaccagaaaataatgactccaaaaatgaaacttcagaaaaaactgtagaagaa
gttccagtaaatccaacagaaggctctacagaaggaacctcaaatcaaggaacagaaaat
ccagttcaatctgcagaagaatcaacaacaaactcaggagaagatgcaactcctaagtca
ggagaaaaatcaggagagactaaagaagaatctacagacgcttcagaagttccttctgca
actccagtcgagaaaccgaaagaaactgataaggtcaaagaagagggttcactagaatca
aatgtttctaaaatggaaacccccaacacagaagacgcttcggaagggaatacttcatct
acaatgagcagtcctcagacggatgaagaatccaagataaatgctccaaaggatgagctt
cctaagacagaactggaggaaagtgaacatcctaatagtagtaatgtagctacagagtcc
actgaaactaaagctgatacattatctagtgatatgaactcagaagtggaaagtcactct
acacctccaaccgtagattcttctcaaaacggagagaatcttggaaaacaaggagaagat
gcaactcctaagccaggagaaaactcaggagagactaaagaagaatccacagacgcttca
gaagttcattctgcaactccagtcgagaagccgaaagaacaagaaccagaaaaaactgta
gaagaagttccagtaaatccaacagaagtcactacagaaggaacctcaaatcaaggagta
gaaaatccagttcaatctgcagaagaaacaacaacgaattcagagaatgtatcaccagat
acatctaaagaaaatactggggaaatgtccagtattcctagtgattcgacaacctcagtt
gaagaaacaaacaaacctgaaaaagatgagtcaaaagacgaaacttcagaaaaaactgta
gaagaagttccagtaaatccaacagaaggctctacagaaggtacctcaaatcaagaagca
gaaaatccagttcaacctgcagaagaaacaacaacgaattcagagaatgtatcaccagat
acatctaaagaaaatactggggaaatgtccagtattcctagtgattcgacaacctcagtt
gaagaaacaaacaaacctgaaaattctgctcatccaataacagagagcggacaaacagaa
ccagaacaatcaaacggaaattcaactgaggatgtttcaagcgaatcaaacacagccaat
tcaaatggaaacgaagaaattaaacaagaaaatgaagtagaacctgataaaaaagtagaa
gttcaagagaaaacaatagaactaagaagtgtttctgatgtggagctctatagttatgaa
gataatcaatcaaaacaacatacaagtttggataaagtaccagataataaatctgcttat
ttcattaaggtgaagtcagctaaatttaaagatgtactgcttccagtttcaaacattgag
gatactacaaaagatggcaaaccagtctataaaatcacagctagattggaacacttgaag
caatctgtagacaatcaataccaagacaattttacatattatcttccaaaacttgttcaa
aatgatggccctatctacacatcatttaaaaaattaataactgatatgaatagtagacca
agtggaacattcacacttggtgcaacaatgaatgctcgcgagtttgagttaaatgaaaac
caagaaagttatgttacaaataactttacagggacattgattggtagtcatcaaggtaaa
cattatgctatctataatttgaaaaagccattattcaatacattaaatagagctactgtt
aaggatctcaccttaaaagatgttaatatttctggtaagaatcatgtcgcatcagttgct
aaggaagccacaaattcttcaactttagataacgttcacgcaaatggaatcattgctggt
gagctaggtatcggaggacttgtccaaaaagttgataattctacagtaagaaatagtagc
ttcaccggaagaataacaaatacctttgttacaaagtctcagtatgcaattggtggctta
gtaggacaattaactggatctaattctgtagtagatcattctatttcaacagtaaccatt
tcaagtaatggagaacattctaatcaaacaattggtggaattgcaggtatcgtagaaaat
aatgcaactgtaaaaaatagttatgctgaaggtgaaataaataatgctaaaccattcgct
agagttggtggagttgcaggttccctttggacaaatggctctagcacggaggacaattct
gggattctacaaaatgtcctaagcgatatgaatattacaaatgggaatgcgatttctggt
taccacttcaatggtatgaagaaaacagcagtttacagtaataaagacaataaggtagtt
aatgttcaagcagttggagatgaggtaatgtcagttgattccactgtagaacgtggtact
gagattgaaaaagaagcagttcaagccaagaaagaccagattactacaaagaaaactata
accgtggaagatttcacaaattctgctaaacaggatgtagattataccaaggccactcat
tatcaagcggcaagagaagttgcatataaaaatatagaaaaattattgcctttctataat
agagacaccattgtgaagtatggaaatcaattgtcagctgataataatctatttaagaaa
gaattgttatctgttgtcgctatgaaaaatgaggaagtggtttcagatattacttcagac
aagcactctatcaatcacttattactacattacaaagatggaacatctgagaaagtaaac
gtaacctaccatagtgattttgcaaatctggctgagtatactattggaactacaggtcta
gtatacacaccaaatgctttcctaaaagattattcatctataatagacagagttaaaaac
gacttaaatacagtgcagtataatccatctgctcttaagaatttgttaggaatctctgat
aatgttaaattaacagaactctatctagatgaacaattcgctaaaaccaaagagcacttg
actgagactcttaaaaaattactttcagctgatgctgctgttactggaaataatagtgct
attgacaattacatggttgataaaatcaagcgaaacaaagaagccttgatgctaggatta
acctatctagaacgctggtatgatttcaaatttgataaggctagcgcaaaagatttgctt
atgttccatatggatttctttggtaagggaaatacctctccgctagatacaattattgaa
ctaggtaaatctggctacaacaatctcttggcaaaaaataatgtggttacttacaatgcc
ttgctgacgaataactacggtacaaaagacctgtttagtgctttagaaggctatcgtaaa
gcatttgcacctactcaaactaacaatgactggtttaaatcacagaccaaggcttatatc
gttgaagaaaaatctaatattccagaagtgagggctaaccaggaaaaagctggtagcaag
tactctatcggtgtctatgatcgaatcactagcgacagctggaaatatcgtaacatggta
ctacctctacttaccttgccagaaaaatcagtatttgtcatttcaactatctctagtcta
ggctttggtgcttatgatcgttatcgcaatagtgactataaggctggtgataagctcaat
aagtttgttgaaaagagtgctcacgaaacagcagagcgtcaacgagatcactatgattat
tggtatcgtattctagatgaaaaagggcgtgaaaagctttatcgaaatatcttgctttat
gatgcctataaatttggaaatgataatactgaaggaaaggctaaaaaagtagcagatttt
gatgatccaaatcctgctatgaaacatttctttggacctgttggaaataatgttggacat
aatcaacacggtgcttatgctacaggggatgccgtttattatatgggttatcgtatgttg
gataaggatggagctatcacttatactcatgaaatgacgcacgattcagatcaggacatt
tatcttggaggatatggtcgaagaagtggtttgggaccagagttcttcgccaaaggctta
ttacaagcgccagaccatccaaatgacgcaaccatcaccatcaactcgatcttgaaacat
tcaaaatctgatagtacagaaggacaacgattacaagtacttgatccaaccacgagattt
aaagacgcaacagatcttcagaactacgtccacaatatgttcgatgtcgtttacatgttg
gaatatctcgaaggaaaatctattacagagaaccttaccaattatcagaaaatggaagct
cttagaaaaattgagaacaagtatgtagaagatcgtgaagatggaaataaggtttacgca
acaaatgtagtcaaagatttgacagtagaagatgctaaaaaactgacaagctttgagagt
ttgattgataataacatcctttcagctcgtgaatacaagtctaaagaatacgaaagaaat
ggctacttcactattaagttatttgcaccaatttatgcagcattaagtagtgatatagga
acaccaggtgacctgatgggacgtcgtatagcctatgaactactagctgctaaaggcttt
aaagatggtatggtaccatatatctcaaaccaatacgaagaagaagccaaacaaaatggt
aaaaagataactatttatggtaaagaacgcggattggtgacagatgacttggttttgaaa
aaggtatttaacggtcaatataaaacttggacagaattcaagaaagctatgtacaaagaa
cgccaagataagtttggacaattaaatacagtgtcatttaaggatccatcaattccttgg
tatattcgcgaaacaaaaactatcaatagcgtgactgaattacagaaattaatggatgaa
gctgttcgtaaggatgcagaagataatcgttattcttggtataactataatccagaatat
gatagtgcggttcataagttgaagagagcaatctttaaagcctatcttgaccaaaccgat
gattttagaagttcaatttttgagaataaaaaatag

DBGET integrated database retrieval system