KEGG   Streptococcus pseudopneumoniae: SPPN_07730Help
Entry
SPPN_07730        CDS       T01590                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
std  Streptococcus pseudopneumoniae
Pathway
std00010  Glycolysis / Gluconeogenesis
std00051  Fructose and mannose metabolism
std01100  Metabolic pathways
std01110  Biosynthesis of secondary metabolites
std01120  Microbial metabolism in diverse environments
std01130  Biosynthesis of antibiotics
std01200  Carbon metabolism
std01230  Biosynthesis of amino acids
Module
std_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
std_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:std00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPPN_07730 (tpiA)
   00051 Fructose and mannose metabolism
    SPPN_07730 (tpiA)
   00562 Inositol phosphate metabolism
    SPPN_07730 (tpiA)
Enzymes [BR:std01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SPPN_07730 (tpiA)
Exosome [BR:std04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SPPN_07730 (tpiA)
  Exosomal proteins of bladder cancer cells
   SPPN_07730 (tpiA)
  Exosomal proteins of melanoma cells
   SPPN_07730 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEL10972
UniProt: G0IBJ2
Position
complement(1477963..1478721)
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFVEAVASKLPSSDLVEAGIAAPALDLTTVLAAAKGSNF
KVAAQNCYFENAGAFTGETSPQVLKEIGTDYVVIGHSERRDYFHETDEDINKKAKAIFAN
GMLPIICCGESLETYEAGKAAEFVGAQVSAALAGLTAEQVAASVIAYEPIWAIGTGKSAS
QDDAQKMCKVVRDVVAADFGQEVADKVRVQYGGSVKPENVASYMACPDVDGALVGGASLE
AESFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttatcgctggtaactggaaaatgaacaaaaatccagaagaagct
aaagcatttgttgaagcagttgcatcaaaacttccttcatcagatcttgttgaagcaggt
atcgctgctccagctcttgatttgacaactgttcttgctgctgcaaaaggttcaaacttt
aaagttgctgctcaaaactgctactttgaaaatgcaggtgctttcactggtgaaactagc
ccacaagttttgaaagaaatcggtactgactacgttgttatcggtcactcagaacgccgt
gactacttccatgaaactgacgaagatatcaacaaaaaagcaaaagcaatctttgcaaac
ggtatgcttccaattatctgttgtggtgagtcacttgaaacttacgaagctggtaaagct
gctgaattcgtaggtgctcaagtatctgctgcattggctggattgactgctgaacaagtt
gctgcatcagttatcgcttatgagccaatctgggctatcggtactggtaaatcagcttca
caagacgatgcacaaaaaatgtgtaaagttgttcgtgacgttgtagctgctgactttggt
caagaagtggcagacaaagttcgtgttcaatacggtggttctgttaaacctgagaacgtt
gcttcatacatggcttgtccagacgttgacggtgcccttgtaggtggtgcgtcacttgaa
gctgaaagcttcttggctttgcttgactttgtaaaataa

DBGET integrated database retrieval system