KEGG   Streptococcus pseudopneumoniae: SPPN_08265Help
Entry
SPPN_08265        CDS       T01590                                 

Definition
(GenBank) sialidase A (neuraminidase A)
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
std  Streptococcus pseudopneumoniae
Pathway
std00511  Other glycan degradation
std00600  Sphingolipid metabolism
std01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:std00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    SPPN_08265
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SPPN_08265
Enzymes [BR:std01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     SPPN_08265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CW_binding_1 Trypsin_2 Trypsin G5 SCNM1_acidic
Motif
Other DBs
NCBI-ProteinID: AEL11077
UniProt: G0IC28
Position
complement(1594348..1598085)
Genome map
AA seq 1245 aa AA seqDB search
MFLYLKGLGKFRKSKAYGLVGCLALVSMIGLSIPDLPVVGGRTVYADVIQGGDDIKDVSV
HEKSAEGVAMTYTTYDSGTSGKQTASGSGVFVAPNVMVTVAHNYYDKNQENKSAVLRGGE
SARSYVVMNSETEKNNKVPTSGVSEALEKDSIHLYNGNDFGKDYSNDLAVVVTKKPVEAM
TGGEDSPRELSHKEVSTGDKITMVGYPNDFSTPNLSEENKKRLKDGKAYSVSTTVSSVNK
ESGAVTYHSSALGGFSGAPLFNDKGDVVGIHQHGTNTSNAPESERIGGGTIFTEKHRAWI
RSMIDKYGIKGWYIDGANRYYYDENHRALKDVEYEIDGALYRFDEKGRATLVKGEEKGRV
LLRVEDTKGTPLISDKVVQEGPVGSGLNFHLRQNPDFKQLIATSPTAKVVSYNGVSVNKL
VSDTSWSDEYVSKLALGNTIIKAVVDSVNPSSTSSSDFARTEVGKVDLSGKSNLPMPSKE
VLQAPNGSENFYATTHIQTPDGSGSGTLIAPNLVLTVAHNFLTVKGSEVVTKSGRTNTVY
KATLPNGLSVHFSDDDIVYWNKKDSVFGFKNDLALVRLKEDFKAVSPVEVVSESTSIAKG
EKVSVYGFPDGRLSPVLDSEVVDTTDFGSGVEGISYEGTKPGASGGGLYNDKGTLIGVHQ
NGVVGSRSGGLVLSKEQLDWVRSYIEGKPKEPVYVKDEVLVDEKDKDKLPSTPKDEKPST
PKIESDKDKVEPPLKPQKEPKTEVITTYEGDSTLEVGKERTEDTKGEKEGVPLIYRVVYK
GTKPKVEKESIAFDTLYQGDETKELGFRSVVEGKGGVVTRTTTYQVDKYTGAVSSQVSEK
KIAPQSKVITLGIKPNSVIKELPITERFEDSEELEKGKTEVVSEGYVGKEVTKVTYKVLA
DGKIVENSRTVEVTPMKERVVLKGVKEVVSSTEENSSNLKEEVVSPDKVEFPVPKDAPIR
EELPASSEEFSESEVLVSGEKIPGDLGKSIVSSKELVPERVEVPDFVAKVTGGEKLTVEG
HRDERKIKTPSKQERLSSPETTAQFTTNGTGSSSLTAVFGVEADNMSLSTVEHSVITYNQ
QRGWHKINNQWYFRNSDGKERTGWMKENDAWYYFDANGIMQTGWIQDTDGNWYYLKDNGM
MEVGWFQDSSGAWYYLGSSGSMESNTWIYYKGKWYYLGSSGSMESNTWIYYKGKWYYLGS
SGSMESNTWIYYKGKWYYIDAFGKLLFNSLTPDGYRVNEYGEWIN
NT seq 3738 nt NT seq  +upstreamnt  +downstreamnt
atgtttttatatttaaagggtttaggaaaatttcgtaagtcaaaagcttatggattggtg
ggatgtctggcattggtgagtatgattggattgtcgattcctgatttaccagttgttgga
ggaagaacagtgtatgctgacgtcattcaaggtggcgatgatataaaagatgtgagcgtt
catgagaagtccgctgagggtgttgctatgacttataccacttatgatagtggtacgagt
ggaaaacaaaccgcgtctggcagtggtgtctttgtagcgccgaatgtcatggtaaccgta
gctcataattactatgataaaaaccaagaaaacaagtccgcggtcttgcgtggtggggag
tctgctcgtagttatgttgtgatgaactcagagacggaaaagaacaataaagtacctact
tctggtgtatcagaagctcttgaaaaagactctattcacttatataacggcaacgacttt
ggtaaagactatagcaacgacttagcagtagtggtaactaaaaagcctgtagaagctatg
acgggtggtgaggactctccaagagagttgagccataaagaggtttctactggtgataaa
atcactatggtaggttatcccaatgatttttcgactccgaatttaagtgaagaaaacaag
aagaggttgaaagatggtaaggcttattcagtctcaacaactgtaagcagtgtcaataaa
gagagcggtgcagtcacttatcattcctcagctttgggaggtttttcaggtgctcctttg
tttaatgataagggagatgtagtcggtatccaccagcacggaacaaatacttcaaacgct
cctgagagtgagcgtattgggggtggtacgatttttacggaaaagcacagagcttggatt
cgttctatgattgataaatatggtataaagggttggtatatagatggtgcaaaccgttac
tattatgatgaaaatcacagagccttaaaagacgtagagtatgagattgacggtgctttg
tatcgttttgatgaaaaaggtcgagcgactttagtaaaaggtgaagaaaaaggccgcgtt
ctacttcgagtggaagatactaaaggaactcctttgatttcagataaggttgttcaggaa
ggtcctgttggaagtggtttgaattttcatttaagacaaaatccagacttcaaacagtta
atagcaacttccccaacagctaaagtggtatcttacaatggagtttctgtcaacaaacta
gtaagtgatactagttggtctgatgagtatgtcagtaagttagctttaggtaataccatt
ataaaagctgttgttgactcagtaaatccttcatctacttcgtcttctgatttcgcaaga
actgaagttggtaaggttgacttgagtggcaaatccaacttacctatgcctagtaaagag
gtgttacaagctccgaatggctcagaaaatttctatgctacaacgcacattcaaacgcca
gatgggtcggggtcaggtactttaattgcacccaatttggtgttaacagtcgctcataat
tttttaacagttaaaggttctgaggtcgttacgaaatctggtcgcaccaatacagtgtat
aaagcaactttaccgaatgggttgtctgtgcatttttcagatgatgatattgtttattgg
aataaaaaagattccgtatttggatttaaaaatgacttagccttggttcgactaaaagaa
gatttcaaagcggtatctcctgtagaggtggtttctgagtcaacttctatcgctaagggt
gaaaaagtttcggtttatggtttcccggatggtcgtttatctccagtcttggatagtgaa
gttgtagatactactgatttcggttcaggtgttgagggtatcagctatgaaggcacaaaa
cccggagcgtctggtggtggtctttataatgacaaaggtactttaattggagttcaccaa
aatggtgtcgtaggaagccgcagtggtggtttggttttatcaaaagagcaactggattgg
gttcgttcttatattgaaggtaaaccaaaagagcctgtctatgtaaaagatgaagttttg
gtggatgagaaggataaggataaacttccttcaactccaaaagacgaaaaaccaagtaca
cctaaaatagagtctgataaagataaagtagaacctcctctcaaaccgcaaaaggagccg
aaaacagaggttattaccacttacgaaggtgacagtacccttgaggttggaaaagagcgt
acagaggatactaagggtgaaaaagaaggtgttccacttatttaccgagtagtgtataaa
ggtactaagccgaaagtagaaaaagaatcgattgcttttgatactctttaccaaggagat
gaaacaaaagagcttggtttccgttcagttgtagagggtaaaggaggggtggttactcga
actactacttatcaagtagataagtatacaggagcggtatcttctcaagtttctgagaag
aaaatagctcctcaatccaaggtgattactttaggtattaaacccaacagtgtcataaaa
gaacttccgattacagagcgttttgaggactctgaagagttagagaaagggaaaacggag
gttgtttcggaggggtatgtaggtaaagaagttactaaggtgacttataaggtcttagct
gatggaaagattgttgaaaattctcgtacagtcgaggttacacctatgaaagaacgtgtg
gttcttaagggtgtgaaggaagtggtgtcatcgacggaagaaaactcaagtaatctcaaa
gaggaagtggtatctccagataaagtagagtttccagttccaaaagatgcgccgatcaga
gaagaactgcctgcgtctagtgaggaattttcagaatcagaggttttagtatcgggagaa
aaaataccaggcgaccttgggaagtctatagtatcttcaaaagaactagtccctgaaaga
gtggaagttccagactttgtggctaaagttacaggtggagaaaaattgacagtagaaggg
caccgagatgagagaaaaataaagactccatcaaaacaggaaagattatctagcccagaa
accactgctcaattcacaacgaacgggacaggttcgtcatcgttaacagctgtttttggc
gttgaagcggataacatgtcactttctactgttgaacattctgttattacatataatcaa
caaagaggatggcataagataaataatcagtggtattttagaaattccgatgggaaagaa
cggacaggctggatgaaagaaaatgatgcatggtattattttgatgcgaatggaatcatg
caaaccggttggatacaggatacagacggtaattggtattatctcaaggataatggcatg
atggaggtaggctggttccaagattcaagtggcgcgtggtactacttaggatcatctggt
tccatggaatccaatacatggatttattataaaggaaagtggtactacttaggatcatct
ggttccatggaatccaatacatggatttattataaaggaaagtggtactacttaggatca
tctggttccatggaatccaatacatggatttattataaaggaaagtggtactatatcgat
gcttttgggaaactacttttcaattcgctaacaccagacggctatagagtgaacgagtac
ggggaatggatcaactga

DBGET integrated database retrieval system