KEGG   Streptococcus pseudopneumoniae: SPPN_09325Help
Entry
SPPN_09325        CDS       T01590                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
std  Streptococcus pseudopneumoniae
Pathway
std00260  Glycine, serine and threonine metabolism
std00750  Vitamin B6 metabolism
std01100  Metabolic pathways
std01110  Biosynthesis of secondary metabolites
std01120  Microbial metabolism in diverse environments
std01230  Biosynthesis of amino acids
Module
std_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:std00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPPN_09325
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SPPN_09325
Enzymes [BR:std01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SPPN_09325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP DUF4252
Motif
Other DBs
NCBI-ProteinID: AEL11277
UniProt: G0I6Z1
Position
complement(1771889..1773373)
Genome map
AA seq 494 aa AA seqDB search
MTLVYQSTRDANNTVTASQAILQGLATDGGLFTPVTYPKVDLDFDKLKAASYQEVAKIVL
SAFLDDFTAEELDYCINNAYDSKFDTPAIAPLVKLDGQYNLELFHGSTIAFKDMALSILP
YFMTTAAKKHGLVNKIVILTATSGDTGKAAMAGFADVPGTEIIVFYPKDGVSKVQELQMT
TQTGGNTHVIAIDGNFDDAQTNVKHMFNDGALRERLAANKLQFSSANSMNIGRLVPQIVY
YVYAYAQLVKTGEIVAGDKVNFTVPTGNFGNILAAFYAKQIGLPVGKLICASNDNNVLTD
FFKTRVYDKKREFKVTTSPSMDILVSSNLERLIFHLLGNDAVKTAELMNALNTQGQYELT
NFDAEILDLFAAEYATEEETAAEIKRVYESDSYIEDPHTAVASAVYKRYQAATGDVTKTV
IASTASPYKFPVVAVEAVTGKSGLGDFEALAQLHDISGVAVPPAVDGLETAPVRHKTTVA
AANMQAAVEAYLGL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacattagtttatcaatcaacgcgtgatgccaacaatacagtaactgctagccaagct
attttgcaaggtttggcgacggacggcggtttgtttacaccggttacttatccaaaggta
gatttggactttgacaaattgaaagctgcttcttatcaggaagttgctaagattgttttg
tcagcatttttagatgactttacagctgaagagttggactactgtatcaacaatgcctac
gatagtaaatttgatactccagctatagcgcctttggtgaaattagacggtcaatacaat
ttggaactgttccatggttcaacgattgcctttaaggatatggccttgtctattttgcca
tactttatgacaacagctgctaagaagcatggtttggtgaacaagattgtcatcttaaca
gcgacatctggtgacacggggaaagctgctatggcggggtttgcggatgtgcctggtact
gagattattgtcttttatccaaaggatggtgtcagcaaggtacaagagttgcaaatgacc
actcagactggtggtaatactcatgttatcgcaatagatggtaactttgatgatgcccaa
acaaatgtgaagcatatgtttaacgatggggctcttcgtgaaagattagcggccaacaag
ttgcaattttcatctgcaaactctatgaacattggtcgtctggtgccacagattgtttat
tatgtttatgcctatgctcagttggttaagactggtgagattgtggctggtgataaggtc
aacttcacagtaccaacaggaaacttcggaaatatcttggctgccttttatgccaaacaa
atcggcttaccagttggtaaattgatctgtgcttcaaatgataacaatgttttgacagac
ttcttcaagacacgtgtttacgacaagaaacgtgagtttaaggtaacaactagtccatct
atggatattttggtatcttcaaacttggagcgtttgattttccatcttttgggtaatgat
gcggttaagacagctgaactcatgaatgctttgaatacacaaggtcaatatgagttgact
aattttgatgcagagattcttgatctctttgcggctgaatatgcaactgaggaagaaaca
gcggcagaaatcaagcgtgtttatgagtcagattcttatatcgaggatccacatacggcg
gttgcctcggcagtttataagagataccaagcggctactggcgatgtgactaagacagtg
attgcttcaacagcgagtccatacaagttcccagtggttgcagtagaagctgtaactgga
aaatcagggcttggcgactttgaagccttggctcaattacatgatatttcaggagtggca
gtgccgccagcagttgatggccttgaaacagctccagttcgtcataagacaactgtggcg
gctgctaacatgcaagcagcggttgaggcttatctaggactttaa

DBGET integrated database retrieval system