KEGG   Streptococcus thermophilus LMD-9: STER_1201Help
Entry
STER_1201         CDS       T00414                                 

Definition
(GenBank) 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase
  KO
K01814  phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase [EC:5.3.1.16]
Organism
ste  Streptococcus thermophilus LMD-9
Pathway
ste00340  Histidine metabolism
ste01100  Metabolic pathways
ste01110  Biosynthesis of secondary metabolites
ste01230  Biosynthesis of amino acids
Module
ste_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ste00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    STER_1201
Enzymes [BR:ste01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.16  1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase
     STER_1201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_biosynth QRPTase_C Dus PcrB Trp_syntA NanE DUF2399
Motif
Other DBs
NCBI-ProteinID: ABJ66391
UniProt: Q03K81
Position
complement(1108788..1109507)
Genome map
AA seq 239 aa AA seqDB search
MQILPAIDIKDGQAVRLFKGDFNQKTVVNPDIIEQAKTFKNAGIQFIHLVDLDGTLDGRA
TNRDLITEVKKISGLGIEVGGGIRTLEQIRDYLAVGIDRIIIGSMAVKDPDFVRAALEEF
GADRIVVGIDAKAGLVATEGWLETSNVDYITLAKEMEKMGVTLFIYTDVDRDGTLTGPNL
DHYKCLVSELTTAKVIASGGVAELADLNHLQEIGVAGTIVGKAYYNGNITLDQLKSFGG
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattctaccagcaattgatattaaggatggacaggcagttcgtctcttcaaagga
gatttcaaccaaaaaaccgtcgtcaatccagatattattgagcaagcaaagacttttaag
aatgcgggcatccaattcattcaccttgttgacttggatggtactcttgatggtcgtgcc
actaaccgtgacttgattacagaggtcaagaagatttctggacttggcatcgaagttggt
ggcggtatccgcaccttggagcagattcgtgactatttggcagttggcatcgaccgtatc
attatcggttcaatggccgtcaaagatcctgacttcgttagagcagctttggaggaattt
ggtgccgataggattgtcgtgggtatagatgccaaggcaggtcttgtcgctacagaaggt
tggttggaaaccagtaatgtggactacatcaccttggccaaggaaatggaaaaaatgggc
gtaaccctctttatttatacagacgttgatcgagatggcacactgacaggacccaatctt
gatcactacaaatgtttggtatctgaactcacaaccgctaaagtcatcgcttcaggtggg
gttgcagagctagccgacttaaatcacttacaagagattggtgtagcaggaaccattgtc
ggtaaggcctactataacggcaatatcactttagaccagctcaagtctttcggaggttaa

DBGET integrated database retrieval system