KEGG   Streptococcus thermophilus LMD-9: STER_1214Help
Entry
STER_1214         CDS       T00414                                 

Definition
(GenBank) Predicted sugar phosphatase of the HAD superfamily
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
ste  Streptococcus thermophilus LMD-9
Pathway
ste00627  Aminobenzoate degradation
ste01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ste00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    STER_1214
Enzymes [BR:ste01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     STER_1214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 Hydrolase_3
Motif
Other DBs
NCBI-ProteinID: ABJ66403
Position
complement(1119433..1120206)
Genome map
AA seq 257 aa AA seqDB search
MTYKGYLIDLDGTIYKGKDRIPEGEAFVKELQKRQIPYLFVTNNSTRTPEMVQELLCNQC
ELETPLETIYTATLATVDYMNDMNRGKTVYVIGETGLKSAIADAGYTVDEENPDYVVVGL
DRDVTYEMLVKATLAIHKGAMFIGTNPDLNIPTERGLLPGAGSLLALIEAATRVKPIIIG
KPKAIIMNKALEILGTERSQTIVVGDNYLTDITAGIKNDFPTLLVTTGFTKAEEVVDLPV
KPDHVLASLAEWDFDAN
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacatataaaggttatttgattgatttagatggaaccatttataaggggaaggatcgt
attcctgaaggggaggcctttgttaaggagttgcagaagcgccagattccctatcttttt
gtgactaataacagtacgcgtacaccagagatggtccaagagcttttgtgtaatcagtgc
gagttggaaacgcctcttgaaactatttatacagcaaccctggcgacagttgactacatg
aatgatatgaatcgtggtaagacagtttatgttattggtgagactgggcttaaatctgct
attgcggatgcgggttatacggtagatgaggaaaatcctgattatgtggtagtgggattg
gaccgtgatgtcacttatgaaatgctggttaaagcaacccttgctatccataaaggggct
atgtttattgggacaaacccagatttgaatatcccaacagaacgaggtctgcttccaggt
gctggttccctcttggcccttattgaggcagcgacgcgtgtgaaaccaatcattattggt
aagcctaaagctattatcatgaacaaagctcttgaaatccttggaacagaacgtagccaa
actattgtggttggtgataattacttgactgatattacagctggcattaaaaatgacttt
ccaacacttcttgtgacgactggtttcaccaaggcggaagaagttgtggatttaccagta
aaaccagaccatgtacttgctagtctagcggagtgggattttgatgcgaactaa

DBGET integrated database retrieval system