KEGG   Streptococcus thermophilus LMD-9: STER_1592Help
Entry
STER_1592         CDS       T00414                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
ste  Streptococcus thermophilus LMD-9
Pathway
ste00970  Aminoacyl-tRNA biosynthesis
ste01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ste00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    STER_1592
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ste03029]
    STER_1592
Enzymes [BR:ste01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     STER_1592
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     STER_1592
Mitochondrial biogenesis [BR:ste03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    STER_1592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: ABJ66742
UniProt: Q03J80
Position
complement(1490929..1491231)
Genome map
AA seq 100 aa AA seqDB search
MKITQEEVTHVANLSKLKFSPEETAEFATTLSKIVDMVELLEEVDTTGVAPTTTMADRKT
VLRPDVAEKGTDRDRLFKNVPEKDNYYIKVPAILEDGGDA
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattacgcaagaagaggtaacccacgttgccaatctttcaaaattgaaattctct
ccagaagagacagctgagtttgcgacaaccttatcgaagattgttgatatggtggaattg
ttggaagaagtggatacaactggtgttgccccaacaacgaccatggcggaccgcaagact
gtactgcgtccggatgttgctgaaaaagggactgaccgtgaccgtttgtttaaaaatgta
cctgaaaaagataattactacatcaaagtaccagctatcctagaagatggaggagatgcc
taa

DBGET integrated database retrieval system