KEGG   Sporolactobacillus terrae: C0679_02630Help
Entry
C0679_02630       CDS       T05792                                 

Definition
(GenBank) D-lyxose/D-mannose family sugar isomerase
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
stea  Sporolactobacillus terrae
Pathway
stea00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:stea00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    C0679_02630
Enzymes [BR:stea01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     C0679_02630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyx_isomer Cupin_2
Motif
Other DBs
NCBI-ProteinID: QAA24578
UniProt: A0A410D699
Position
510054..510566
Genome map
AA seq 170 aa AA seqDB search
MSHQVKNRALKMYADAHIALSSDEIENMEFADFGLGRIEKEGLILVVYENNDRYCSKEMV
LLPGMTCPEHRHPDHDGQIGKQETFRCRQGQVYLYVEGKPTDNIQASIPEGSKDYYTIRH
EIVLYPGEQYTIKPNTLHWFQAGAEGAIVSEFSSPSDDSTDIFTDPNIVR
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgagccaccaagttaaaaacagagcattaaaaatgtatgccgatgcacatatagcattg
agctcagatgaaatcgagaatatggagtttgctgatttcggcttaggtcgtattgaaaaa
gagggtcttattttagtggtgtacgagaataacgacagatattgctcaaaggagatggtt
ttattgcctggaatgacttgcccggagcatcgccatccagatcatgatggtcaaattgga
aaacaagaaacatttcgctgccgtcaaggtcaggtatatctctatgttgagggtaagcca
accgataacattcaggccagtattcctgaggggagcaaagactattatacaattcgccat
gaaattgtattgtatcctggtgaacaatatacgatcaaaccaaatacgctgcattggttt
caagcgggtgctgaaggcgcgatcgttagtgagttttcttcaccaagtgatgattcaacg
gatatctttacagatccaaacatcgtaagataa

DBGET integrated database retrieval system