KEGG   Sporolactobacillus terrae: C0679_03600Help
Entry
C0679_03600       CDS       T05792                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
stea  Sporolactobacillus terrae
Pathway
stea00450  Selenocompound metabolism
stea00970  Aminoacyl-tRNA biosynthesis
stea01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stea00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    C0679_03600
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    C0679_03600
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:stea01007]
    C0679_03600
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:stea03016]
    C0679_03600
Enzymes [BR:stea01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     C0679_03600
Amino acid related enzymes [BR:stea01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   C0679_03600
Transfer RNA biogenesis [BR:stea03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    C0679_03600
 Prokaryotic type
   Other AARSs
    C0679_03600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f DZR Laminin_EGF tRNA-synt_1d HypA
Motif
Other DBs
NCBI-ProteinID: QAA24755
UniProt: A0A410D6N1
Position
733880..735514
Genome map
AA seq 544 aa AA seqDB search
MAVLIAGAWPYANGDLHLGHLSSLIPGDCLARYFRQKGEKVLYVSGSDCNGTPITIRAKQ
EGVSAKTIADRYHEAFQRCFDQLGFTYDCYTRTDTPLHHEVVQDIFSTLYDNGYIYHKKT
KQMYCSHCAQFLPDRYVEGACPHCGAHARGDQCDACSTILDPVDLLDATCKLCGHKPELR
EVEHLYFALSTFQPQLEQLYARAKKNYDWRENALNLTRRYLDEGLQDRAVTRDLPIGVTV
PIKGFEDKKVYVWIEAVSGYYSASVRWAKEHHQDISEFWNEQTVSYYVQGKDNVPFHTII
WPAILLGIGKKALPTHLVSNEYVTLERKKLSTSRNWAVWAPDILEHYDPDSIRYFLLINA
PETHDADFSWKAFIESHNGELLGAYGNFVNRTLKFIEKLPDFKVDVRPVDAHVEQETQAL
YTQIGQLIESAHLKAALGELFTWIRSLNKYFDEQKPWQTITTDPAAAYKTLKTCLFSIAN
LAQLMAPFLPYSSRKLEKALHLNGLKWEAIHCSGKLPEHLEPLFERIDPVQIQVERERLA
QQTV
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggcagtactcatcgcaggcgcttggccgtatgcaaatggagatcttcaccttgggcat
ttatcgagtttgattcctggtgattgtttggcgcgttatttcaggcaaaaaggagaaaag
gtgctctatgtctcggggagcgattgcaatggcacgccgatcacgattcgtgccaaacag
gagggggtatcagcaaaaacgattgcggatcgttatcatgaagcttttcagcgatgtttc
gatcaattagggtttacgtacgactgctacacgcgaacggatacgccgctgcatcatgaa
gtcgtccaggacattttcagcacattatatgacaacggatacatttatcacaaaaaaacg
aagcaaatgtactgcagtcactgtgcccagtttttgccggaccgctatgtcgagggcgct
tgtccgcattgcggggcgcatgcacgcggcgatcagtgcgatgcgtgttcgacgattctt
gatccggttgatctgcttgatgcaacgtgtaagctgtgcgggcataaaccggagcttcgc
gaggttgagcatctgtacttcgcgctcagtacatttcagccgcaactggaacaactgtac
gcgcgggcaaaaaagaattatgattggcgggaaaacgcgctcaatttgacgcgtcgctat
ctggacgaggggcttcaggatcgggcggtcactcgtgatttgccaatcggcgttaccgtc
ccgattaagggctttgaagacaaaaaagtttatgtgtggattgaagcggtatccggttat
tactcagcaagtgtccgctgggcgaaggaacatcatcaggacatctccgaattttggaat
gaacaaacggtttcttactacgttcaagggaaagacaacgtaccatttcacacgattatt
tggccggccattctactcggcattggcaaaaaagcgctaccgacacatctagtttctaat
gaatatgtgacactagagcgcaagaagctgtccacaagtcgaaactgggcggtatgggca
cccgatattcttgaacactatgatccggacagtatccgttactttttgttgatcaatgca
ccggaaacacatgacgccgatttttcttggaaggcgtttatcgaaagtcacaacggcgaa
ctgctcggcgcctatggtaactttgtcaaccggacgctcaaattcattgaaaagctgcct
gattttaaagtggatgttcgtccggttgacgcgcatgtcgaacaagaaacgcaagcgctc
tacacgcaaatcggccaattaatcgaatcggcgcatttgaaagcggcactcggcgagctc
tttacgtggattcgcagcttgaataaatattttgatgaacaaaaaccgtggcagacaatc
acgaccgatccagcggcggcttacaagacattgaagacctgtttgttcagtatcgccaat
ttagctcagcttatggccccatttctaccctattcaagtcgaaaactggaaaaggcactg
cacctcaacgggctaaaatgggaagcgattcattgctcgggaaaacttccggagcatctt
gaacccttgtttgaacgcattgatccagttcagatccaagtagaacgtgagcggctcgcg
cagcagaccgtgtaa

DBGET integrated database retrieval system