KEGG   Sporolactobacillus terrae: C0679_03980Help
Entry
C0679_03980       CDS       T05792                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
stea  Sporolactobacillus terrae
Pathway
stea00051  Fructose and mannose metabolism
stea01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stea00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    C0679_03980
Enzymes [BR:stea01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     C0679_03980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UPF0052 3HCDH_N UDPG_MGDP_dh_N AHD
Motif
Other DBs
NCBI-ProteinID: QAA24819
UniProt: A0A410D6X3
Position
808842..809993
Genome map
AA seq 383 aa AA seqDB search
MKEVVHFGAGNIGRGFIGALFSESGYHVSFVDIAEPIIHALNEKQTYKVRTAAEHPETVT
ITNVSGINSKTNPDQVVEAIGKAEYLTTAIGPKVLPFIAPLIAKGLKERLTHTNDKIYVI
ACENQINATDLLKKEVLKALDEATTKKLNGKVFFLNSAVDRIVPLQHNDELLDVLVEDYR
EWIVETNEQLPQVKGMQIVPDLAPYIERKLFTVNTGHATTAYFGYQAGKKKIHQALQDPE
LYQDVKATIEETGAYLIKQYGFKPEVHEQYIEKILHRFQNPKLNDDVTRVGRSPLRKLGA
EDRLVKPAREAQKLGLSFTHLAKVMAAALHFDYSEDAEAESLQHQLKQKGVHAVLHDVSG
LEAEDPIAKEVVHYYENINLLKK
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaagttgtacattttggtgcaggcaatattggaagaggatttatcggcgcttta
ttttcagaatcaggctaccacgtttcgtttgtggatatcgcagagccgattattcatgca
ttaaacgaaaagcaaacctataaggtcagaaccgctgctgagcatccagagacggtcacg
attaccaacgtttccggaatcaacagcaaaacgaacccggatcaagttgttgaagcaatt
ggtaaggcggagtatctgacaacggcaatcgggccgaaagtgttgccgttcatcgcgcca
ctgatcgccaagggactaaaagaacggttgacgcatacaaatgataaaatctatgtgatt
gcttgcgaaaatcagatcaacgcgaccgatttgttaaaaaaagaagttctgaaagcgctt
gacgaagcaacaacgaaaaagctaaatggcaaagtcttcttcttaaactcagcagttgac
cgtattgttccgctgcagcacaatgacgaactactcgatgtactcgttgaagactatcgt
gaatggatcgttgaaacgaacgaacaattaccacaagtaaaagggatgcaaatcgtaccg
gatcttgcgccgtacattgagcgcaaactgttcacggtaaataccgggcatgcgaccacc
gcttatttcggctaccaagcggggaaaaagaagattcatcaagccttgcaggatccggaa
ctgtatcaggatgttaaggcaacgattgaagaaaccggagcctatctgatcaagcagtac
ggctttaagcctgaggtacatgaacagtatattgaaaagattctgcaccgtttccagaat
ccgaaattaaatgatgacgtaacccgtgtcggtcgctcaccactgcgcaaactgggcgcc
gaagaccgtctggtaaaaccggcacgtgaagcacagaaactcgggttgtcgttcacgcat
cttgcgaaagtcatggcagcagcgctgcacttcgattacagtgaagatgcggaggcagaa
agtttgcaacatcaattgaaacaaaaaggtgtgcatgctgttcttcatgatgtaagcggt
ctcgaagcagaggacccgatcgcaaaagaagtcgttcattactatgaaaacattaatctg
ctcaaaaaataa

DBGET integrated database retrieval system