KEGG   Sporolactobacillus terrae: C0679_08205Help
Entry
C0679_08205       CDS       T05792                                 

Definition
(GenBank) nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
stea  Sporolactobacillus terrae
Pathway
stea00230  Purine metabolism
stea00240  Pyrimidine metabolism
stea01100  Metabolic pathways
stea01110  Biosynthesis of secondary metabolites
stea01130  Biosynthesis of antibiotics
Module
stea_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
stea_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
stea_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:stea00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    C0679_08205
   00240 Pyrimidine metabolism
    C0679_08205
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:stea04131]
    C0679_08205
Enzymes [BR:stea01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     C0679_08205
Membrane trafficking [BR:stea04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    C0679_08205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: QAA25589
UniProt: A0A410D958
Position
complement(1726020..1726442)
Genome map
AA seq 140 aa AA seqDB search
MERTFLMIKPDGVRRGLIGTIIARFEAKGFKMIAGKLMTISDELVKKHYYEHEGRPYYND
LTTFMTSGPVFAMVWEGENIIKLARFMMGSTDPEKAAPGTIRGDYATRMNRNVIHGSDSP
ENAAREINLFFNEDECVARL
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggaacgcacatttttaatgatcaaaccagacggtgtacgtcgcggattaatcggcacg
attatcgctcgatttgaagcaaaaggttttaaaatgattgcaggtaagctgatgaccatc
tcggatgaattggttaaaaagcattactatgagcatgaaggaagaccttattataatgat
ttaacgacatttatgacttccggacccgtttttgcaatggtatgggaaggcgaaaatatt
atcaaacttgctcgattcatgatgggttcgaccgatccggaaaaggctgcgccagggacc
attcgcggtgattacgcaacgcgaatgaatcgtaatgtgatccatggatcggattcgcca
gaaaatgcagcgcgggaaatcaatctgttctttaatgaagatgaatgcgttgcacgcctg
taa

DBGET integrated database retrieval system