KEGG   Sporolactobacillus terrae: C0679_11455Help
Entry
C0679_11455       CDS       T05792                                 

Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
stea  Sporolactobacillus terrae
Pathway
stea00561  Glycerolipid metabolism
stea00640  Propanoate metabolism
stea01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stea00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C0679_11455
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    C0679_11455
Enzymes [BR:stea01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     C0679_11455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 SBP_bac_5 ANF_receptor
Motif
Other DBs
NCBI-ProteinID: QAA26163
UniProt: A0A410DAT0
Position
complement(2387680..2388825)
Genome map
AA seq 381 aa AA seqDB search
MEKVFVSPSRYVQGKDVFKKADQYVKKLGDLALVVADETVWKAAAEAFSAQLKKGGIEVV
KEVFQGECSINEINRLTESGKTKKVNVVIGLGGGKTLDTVKAVADHLDTPVVCAPTVASA
DAPTAGLSVIYTDDGAFESYLFYDKNPELVIVDTRIIAESPHRMLVSGISDALATWIEAR
AVAEGHNNTMSGKQPTLAGKAIAETCEKVLFDYALPAIEANQQKIVTPALEAIVEANTLL
SGLGFEDGGLGAAHAIHNGFTALTGDIHHLTHGEKVAYGALTQLVLENKPFDELERYIGF
YLKLGLPTSLKEIHLEKATDEELYKVGEKATAPGETIHQMPFAITADDVVQAIKGVDAYV
KDYKSRHGWSVESEKKLLAVD
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagtttttgtcagcccaagccgttatgtacaggggaaagatgtattcaagaaa
gcggatcagtatgtgaaaaagttaggcgatttagcgcttgtcgttgccgatgaaaccgtg
tggaaggctgctgctgaagccttctccgctcagcttaaaaaaggcggaatcgaagttgtc
aaagaagtctttcaaggcgaatgcagcattaatgaaatcaatcgactgacagagtccgga
aagacgaaaaaagtgaatgtggtgatcggacttggcggcgggaaaacgctagatacggtg
aaggcagtcgcggatcatctggatactccggttgtttgcgcaccgaccgtagcctccgcc
gatgcaccaacggcaggcctgtccgtaatctatactgatgacggtgcttttgaaagctat
ttgttctatgataagaatccggaactcgttattgttgatacgcggattattgctgaatcg
ccgcatcggatgcttgtttcgggtatttccgatgcactggccacctggattgaagcgcgt
gcggttgctgaaggacataataataccatgtccggcaaacaaccgacgttggcaggtaag
gcaattgcggaaacctgcgaaaaagtgctcttcgattatgcgcttcctgcgattgaagcg
aaccaacagaaaattgttacaccggcacttgaagcgattgtcgaagcgaacacgctgctc
agcggtctaggtttcgaagatggcggacttggcgcagcccatgcgattcataacggattt
accgctttgaccggtgatattcaccacctgacgcacggagaaaaggtagcgtatggtgcg
ctgactcagcttgttcttgagaataagccgtttgatgagctggaacgctacattggcttt
tatctgaaacttggtttgccaacctcacttaaagaaattcatcttgaaaaagcgacggat
gaagaactttacaaggtcggtgaaaaggcgacggctcctggagagacgatccatcaaatg
ccgtttgcgattacggcagatgatgtggtccaagcaatcaaaggtgtcgatgcgtatgtc
aaagactataaatctcgccatggctggtctgtcgaaagcgagaagaaattactagcagtg
gactaa

DBGET integrated database retrieval system